Singulisphaera acidiphila: Sinac_2479 Help Entry Sinac_2479        CDS       T02393                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism saci  Singulisphaera acidiphila Pathway saci01100   Metabolic pathways saci01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saci00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sinac_2479   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sinac_2479 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AGA26788 UniProt:  L0DD76 LinkDB All DBs Position complement(3078883..3079128) Genome browser AA seq 81 aa AA seqDB search MADTRTRLNRCFSAVFSDLDETQISQATRDNVDGWDSLATFTLLTVIEEEFQIQVSPEDV DRFTSYENILDCLQGQHSIAC NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctgatacgcgaacccgcctgaaccgttgcttctccgccgtcttctccgacctggac gagacgcagatctcgcaggcgaccagggacaacgtcgatggctgggactcgctggccaca ttcacgcttctgacggtcattgaggaggagttccagatccaggtttcgccggaggatgtg gaccgtttcacgtcctatgagaacatcctcgactgccttcagggacaacacagcattgcg tgctga

DBGET integrated database retrieval system