KEGG   Sulfolobus acidocaldarius SUSAZ: SUSAZ_05715Help
Entry
SUSAZ_05715       CDS       T02975                                 

Definition
(GenBank) alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
sacs  Sulfolobus acidocaldarius SUSAZ
Pathway
sacs00500  Starch and sucrose metabolism
sacs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sacs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SUSAZ_05715
Enzymes [BR:sacs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SUSAZ_05715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57
Motif
Other DBs
NCBI-ProteinID: AHC51490
UniProt: V9S5T8
LinkDB All DBs
Position
988902..990236
Genome map
AA seq 444 aa AA seqDB search
MRNVILGFEVHQPFRIKGSYFWNPQFRDNPIEKYFDNQLNRDVFLRAKQKCYIPATKIIL
DEIERGENEGYDVKVFYSISGTFMEQAEKWGREVIDLLQQLSYTKKVEFLSQTYYHSITG
LWDDLDEWKEQVKQHSELIKEYFNQTPTTFENTELLVTPRILKEVENLGFKSIIMEGKES
VLNGRSPNYVYRIKNSKLVGLLRNYRLSDDIAFRFSNRNWDQYPLTAQKLSDWLLWSEGD
VGLIFVDYETFGEHHWPESGILDFLRWLPRELSRREIKMRLPKEVYDRAVQEIEITQTSS
WADINKDESSWLGNIMQWAYDEMVRRTEMLAKELGKEYLKAWKYFTTSDHYYYLFLGSSS
PAEVHSYFSSFNSPIDAFINEIYAISMFQEEMRKKLKIENEPFIFYKGLKRGKEVWTIDQ
YKELIKQKPEYKDFEKYIQEWIKQ
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatgtcatcttagggttcgaagttcaccaaccctttagaataaaaggaagctac
ttttggaacccacaatttagagataatccgatcgaaaaatattttgataaccagttaaat
agggatgtatttcttagagctaagcaaaaatgctatatacctgcaactaaaataattcta
gatgaaattgagagaggagaaaatgaaggatacgacgtcaaggtattctattcgatatca
ggaaccttcatggagcaggcagaaaagtggggaagagaagtaatagacttacttcaacaa
ctctcatatacaaagaaggtggagtttttatctcaaacctattaccactcgataacaggt
ttgtgggatgacttagatgaatggaaagaacaagttaaacagcactcagagttaataaag
gaatactttaatcaaacaccgacaacttttgagaacactgaactactagttactcccaga
atattaaaggaagttgagaacttaggtttcaaatcaattataatggaaggaaaagagagc
gtactgaacggtagatcaccaaattatgtctacagaataaagaacagtaaattagtaggc
ttactgagaaactataggctaagtgatgatattgccttcaggttttcgaacaggaattgg
gaccaatacccactaactgcacaaaaactctctgactggttactgtggtcagagggtgat
gttggattaatcttcgttgattatgaaacatttggggagcatcattggcctgaaagtgga
atcctagacttcttgaggtggttaccaagagaactttcaagaagggaaataaaaatgaga
ttgcctaaagaggtatatgatagggctgttcaagagatagaaataactcaaacatcatct
tgggctgatataaacaaggatgaatcaagttggttaggaaatataatgcaatgggcttat
gatgaaatggtcagaagaaccgaaatgttggcaaaagagttgggtaaagagtatcttaaa
gcctggaagtatttcacaactagtgatcattattattacctgtttttaggtagtagtagc
ccagcagaggtccactcatattttagctcctttaactcacccattgatgctttcataaac
gagatttacgctatctcaatgtttcaagaggaaatgagaaagaagttaaagatagaaaat
gaaccgtttatattttacaagggtttgaagagaggtaaggaagtttggacgatagaccag
tataaggagctaataaaacaaaagccagaatataaagacttcgaaaagtatattcaagag
tggattaagcaatga

DBGET integrated database retrieval system