KEGG   Stenotrophomonas acidaminiphila: AOT14_25770Help
Entry
AOT14_25770       CDS       T04107                                 

Definition
(GenBank) angiotensin-converting peptidyl dipeptidase protein
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sacz  Stenotrophomonas acidaminiphila
Brite
Enzymes [BR:sacz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AOT14_25770
Peptidases [BR:sacz01002]
 Metallo Peptidases
  Family M2
   AOT14_25770
Exosome [BR:sacz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOT14_25770
CD molecules [BR:sacz04090]
 Proteins
  AOT14_25770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2845281..2847278
Genome map
AA seq 665 aa AA seqDB search
MKQRHLLLALAVSASVLSLAACKKEAATDTAAPAAQAAPAESADQFVARINAEFKAMYPE
MTSAQWLSSTYINDDSARVAAKANERWLTTLNGWIEQAGKYEGQPMSEDTRRALHLLKLM
TAMPAPRDPAKLAELAAIATKLEGDYGAGTYCTGEGDQQNCRQLGELEQVLARSHDYDKQ
LDAWQGWHSTAVASRKPYQRFVELVNEGARELGYADAGQMWRSGYDMPAEQVGPETDRLW
EQVKPLYEQLHCYTRAKLDKEYGKDKAEVGGGLIAAHLTGNMWQQDWSNLWDQLQPYPGA
GSLDITAALEKQHQGNLSAALAKASANADVAARFKAQREAELATARQMTERAQDFYVSLG
MPKLPPSYWQNTQFIKPLDRNVVCHASAWDMNMGGDGKDVGADVRTKMCITPTEENFTTI
YHELGHIYYDLAYNPLPPLFQGGANDGFHEAIGDTIVLAMTPQYLNSIGLVDKPQESREA
TINAQMRMALSGVSFLPFGLMIDRWRWGVFDGSIKPEQYNQKWWELKAQYQGVAPAGARG
EEFFDAGAKYHVPGNTPYLRYFLARILQYQFYKGLCDAAGYTGPLNQCTFYGNKEAGQKY
WAMLSKGASQPWQATLKELTGSEKLDAAPMLEYFAPLQEWLKQQNEGQMCGWQAGPVQPV
KPAAP
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaacgtcatctgctgttggcccttgccgtgagcgccagcgtgctgtcgctggcc
gcctgcaagaaggaagccgccaccgacaccgccgcgccggcggcacaggccgcaccggcc
gagagcgccgaccagttcgtcgcccggatcaacgccgagttcaaggcgatgtacccggaa
atgacctcggcgcagtggctgtcctccacctacatcaacgacgattccgcgcgcgtggcg
gccaaggccaacgagcgctggctgaccacgctcaacggctggatcgaacaggccggcaag
tacgaaggccagccgatgagcgaggacaccaggcgtgccctgcacctgctcaagctgatg
accgccatgccggccccgcgcgacccggccaagctggccgagctggccgccatcgccacc
aagctggagggcgactacggcgccggcacctactgcaccggtgaaggcgaccagcagaac
tgccgccagctcggcgaactggaacaggtactggcgcgctcgcacgactacgacaagcag
ctcgatgcctggcagggctggcactccaccgccgtggcctcgcgcaagccgtaccagcgc
ttcgtcgagctggtcaacgaaggcgcgcgcgagctgggctacgccgatgccgggcagatg
tggcgcagcggctacgacatgccggccgaacaggtcggcccggaaaccgaccgcctgtgg
gagcaggtcaagccgctgtacgaacagctgcactgctacacccgcgccaagctggacaag
gaatacggcaaggacaaggccgaagtcggcggcggcctgatcgccgcgcacctgaccggc
aacatgtggcagcaggactggagcaacctgtgggaccagctgcagccctaccccggcgcc
ggcagcctggacatcaccgccgcgctcgagaagcagcaccagggcaacctgagcgcggcc
ctggccaaggccagcgccaatgccgacgtcgctgcccgcttcaaggcccagcgcgaggcc
gaactggccaccgccaggcagatgaccgagcgcgcgcaggacttctacgtgtccctgggc
atgcccaagctgccaccgagctactggcagaacacccagttcatcaagccgctggaccgc
aacgtggtctgccacgccagcgcctgggacatgaacatgggcggcgacggcaaggacgtc
ggcgcggacgtgcgcaccaagatgtgcatcacgcccaccgaagagaacttcaccaccatc
taccacgagctgggccacatctattacgacctggcctacaacccgctgccgccgctgttc
cagggcggcgccaacgacggcttccacgaggccatcggcgacaccatcgtgctggcgatg
accccgcagtacctgaactccatcggcctggtcgacaagccgcaggaaagccgcgaggcc
accatcaacgcgcagatgcgcatggccctgagcggcgtgtcgttcctgccgttcgggctg
atgatcgaccgctggcgctggggcgtgttcgacggctcgatcaagcccgagcagtacaac
cagaagtggtgggaactgaaggcccagtaccagggcgttgccccggccggcgcacgcggc
gaggagttcttcgacgccggcgccaagtaccacgtgccaggcaacaccccgtacctgcgc
tacttcctggcgcgcatcctgcagtaccagttctacaagggcctgtgcgacgccgccggt
tacaccggcccgctcaaccagtgcaccttctatggcaacaaggaagccggccagaagtac
tgggccatgctcagcaagggcgccagccagccctggcaggccacgctcaaggaactgacc
ggcagcgagaaactcgacgccgccccgatgctggaatacttcgccccgctgcaggaatgg
ctcaagcagcagaacgaaggccagatgtgcggctggcaggccggtcccgtgcagccggtg
aagccggccgcgccgtaa

DBGET integrated database retrieval system