KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0788Help
Entry
SAG0788           CDS       T00091                                 

Gene name
sodA
Definition
(RefSeq) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Brite
Enzymes [BR:sag01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SAG0788 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
786470..787078
Genome map
AA seq 202 aa AA seqDB search
MAIILPDLPYAYDALEPHIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLEALLADV
SQIPEDIRQAVINNGGGHLNHALFWELMSPEETQISQELSEDINATFGSFEDFKAAFTAA
ATGRFGSGWAWLVVNAEGKLEVLSTANQDTPIMEGKKPILGLDVWEHAYYLNYRNVRPNY
IKAFFEIINWNKVNELYQAAKA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcaattattttaccagatttaccctatgcatatgatgcgcttgagccacatattgat
gctgagacaatgacactacatcatgataagcaccatgcaacttatgttgctaatgcaaat
gctgctcttgagaaacatcctgaaattggagaagacttagaggcgctcttagctgatgtt
tctcaaattccagaagatattcgtcaggcagtcatcaataacggtggtggacatcttaac
cacgctcttttctgggaattgatgtcaccagaagaaactcaaatttcacaagagttatct
gaagacattaatgcaacttttggttcatttgaagactttaaagctgctttcacagcagca
gcaacaggacgttttggttcaggttgggcttggcttgttgttaatgctgaaggcaaactt
gaagtgctttcaactgccaatcaagatactccaattatggaaggcaagaaacctatttta
gggcttgatgtatgggagcatgcttattacttaaactatcgtaatgttcgtcctaactac
atcaaagctttctttgaaattattaactggaataaagtaaatgaactttaccaagctgct
aaagcttaa

DBGET integrated database retrieval system