KEGG   Streptococcus agalactiae 2603 (serotype V): SAG1932Help
Entry
SAG1932           CDS       T00091                                 

Definition
(RefSeq) neuraminidase-like protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:sag00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SAG1932
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAG1932
Enzymes [BR:sag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SAG1932
Bacterial toxins [BR:sag02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SAG1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1916030..1918480)
Genome map
AA seq 816 aa AA seqDB search
MTLTFGKPSITIRRLGVITSTYMMLGFILLCGFLHPSTIYSEEIKSDINSFISIDDEKTT
VPIFDSTLDKLTNSIEERQLELDSDTSDSLIVDDQKDKDMVIVLGDSDSQEKLSPPLKSE
IATEENRKQANLAELNATQPNNRTTYIIPESSHSIAEQQRFLIESKGYSVALLNSDEFRK
TAREDRGFERDKLRSLDIIPKGDLSTSNVIGNTDIASQISLGFKKNAIQEHHLTKTFSQK
DGKLSSVIEGMLAIGKEKVEKEIKYSGNLWQKLKAKAHCLVCCVDNLNFEDIKSYFQYYC
HLNHQLKLPKGAILSAKTEVYRGGDFGRKNKDNVFGYRIPSLLKTEKGTLLVGADERIEQ
ACDWGNIGMVIRRSEDDGVTWGKRETIVNLRNNPRVPLVTSGDYSGSPINMDMALVQDTS
SKTKRIFSIYDMFPEGRGVISIANTPEKEYTQIGGQSYLNLYNNGKKSKVFTIRDKGIVY
NFKGKKTDYHVITETTKSDHSNLGDIYKGKQLLGNIYFTKHKTSPFRLAKSSYVWMSYSD
DDGRTWSSPRDITASLRQKGMKFLGIGPGKGIVLKWGPHAGRIIIPAYSTNWKSHLRGSQ
SSRLIYSDDHGKTWHTGKAVNDNRILSNGEKIHSLTMDNKKEQNTESVPVQLKNGDIKLF
MRNLTGNLEVATSKDGGETWQNHVKRYKEVHDAYVQLSAIRFEHDKKEYILLVNANGPGK
KRQDGYARLAQVNRNGSFKWLYHHHIQDGSFAYNSVQQLNNDKFGVLYEHREKHQNSFTL
NYKVFNWSFLSQNTEKQGTLWEKMAANWHVLFKFYL
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgacattaacctttgggaaaccttctataacgatacgccgtctaggagtgataactagt
acatatatgatgctaggttttatcttattatgtggatttttgcatcctagtacaatttat
agtgaggaaataaaatctgatataaactcttttatatcaatagatgatgaaaaaactact
gttcccatatttgactctactttagataagcttactaattcaatagaggagaggcagtta
gaattagattctgatacatcggacagtttaatagtagatgatcaaaaagataaagatatg
gtaatagtcttaggtgattctgacagtcaagaaaaattgtcacctcctctaaaatcggaa
atagcgacagaagaaaatcgtaaacaggcaaatttagcagaactaaatgcaactcaacct
aataatagaactacctatattatacccgaaagcagtcattccattgcagaacaacagaga
ttcctgatagaatcaaagggttattcggttgcattacttaatagcgatgaatttagaaag
acagcgagagaggatagaggttttgaaagggataagttgaggtctttggatatcattcct
aagggagatttatcgacaagtaatgtcataggtaatacggacattgctagtcagatatcg
ttgggctttaaaaagaatgcgatacaggaacaccatcttactaaaacattctctcaaaag
gatggaaagttatcgtctgttatagaggggatgcttgctattggcaaagagaaagtagag
aaggaaataaaatatagtggtaatttatggcaaaaattaaaagctaaggcacactgcctt
gtttgctgtgttgataatttgaattttgaagatataaaatcttattttcaatattattgt
catctaaaccatcagctcaaattacctaaaggtgctatactttctgctaaaacagaagta
tataggggaggagattttgggagaaaaaataaagataatgtgtttggttaccgtatcccc
tcattattaaaaacggaaaaaggaactttacttgtgggagctgatgaaagaattgagcaa
gcttgtgattggggaaacataggaatggttattcgccgtagtgaggatgatggtgtcact
tggggaaaaagagaaactattgtcaatctccgtaataaccctagagttccgctagttact
agtggtgactatagtggctcacctattaatatggatatggcattagttcaagatactagc
tctaagacgaaacgtattttttcaatatatgatatgtttccagaaggaagaggcgttatt
agtattgctaacacacctgaaaaagaatatacccaaatcggaggacagtcttatcttaat
ttatataataatggaaagaaatcgaaggtttttactatccgtgacaaaggtattgtatat
aattttaaagggaaaaagactgattatcatgttataacagaaactactaaaagtgaccat
tcaaatctaggggatatttataagggaaaacagctacttggaaatatatattttacaaaa
cataaaacgtcaccatttcgtttagcaaaatcaagctatgtgtggatgtcatatagcgat
gatgatggtaggacatggtcatcacctagagatataacagcaagtcttcgtcagaaaggc
atgaaatttttaggaataggacctggaaaaggtatagttttaaaatgggggccacacgct
ggtcgtattattattcctgcctattctacgaattggaaatctcatctaagaggttcacaa
tcttcacgcctaatttattcagacgaccatggaaaaacgtggcatactggaaaagcagtc
aatgataaccgtatactttctaatggtgaaaaaattcactccttaacaatggataataaa
aaagaacaaaatacagaatccgtacccgttcaattgaaaaatggggacattaagttattt
atgaggaatctaactggtaacctagaagtagccacaagtaaagacggcggggagacttgg
caaaaccatgttaaacgatataaggaagttcatgatgcttacgtccaattatcagctatt
cgctttgagcatgacaaaaaagagtatattttattagtgaatgctaatgggccaggtaag
aagcgtcaagatggatatgcacgtctagcgcaagttaatcgaaatggtagttttaagtgg
ttatatcaccatcacattcaagatggttcgtttgcttacaactctgttcaacaacttaat
aatgataaatttggtgtcctttatgaacatagagaaaaacatcaaaatagttttacttta
aattacaaagtttttaattggagttttcttagtcaaaatacagagaagcaaggcacttta
tgggagaaaatggcagcaaattggcatgttttgtttaaattttatttatga

DBGET integrated database retrieval system