KEGG   Streptococcus agalactiae NGBS572: EN73_08250Help
Entry
EN73_08250        CDS       T03517                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sagg  Streptococcus agalactiae NGBS572
Pathway
sagg00473  D-Alanine metabolism
sagg01100  Metabolic pathways
sagg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sagg00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    EN73_08250
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    EN73_08250
Enzymes [BR:sagg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     EN73_08250
Peptidoglycan biosynthesis and degradation proteins [BR:sagg01011]
 Precursor biosynthesis
  Racemase
   EN73_08250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TIG
Motif
Other DBs
NCBI-ProteinID: AIF89175
UniProt: A0A076Z2L1
LinkDB All DBs
Position
complement(1603707..1604807)
Genome map
AA seq 366 aa AA seqDB search
MISSYHRPTRALIDLEAIANNVKSVQEHIPSDKKTFAVVKANAYGHGAVEVSKYIESIVD
GFCVSNLDEAIELRQAGIVKMILVLGVVMPEQVILAKNENITLTVASLEWLRLCQTSAVD
LSGLEVHIKVDSGMGRIGVRQLDEGNKLISELGESGASVKGIFTHFATADEADNCKFNQQ
LTFFKDFISGLDNCPDLVHASNSATSLWHSETIFNAVRLGVVMYGLNPSGTDLDLPYPIN
PALSLESELVHVKQLHDGSQVGYGATYQVTGDEFVGTVPIGYADGWTRDMQGFSVIVNGE
LCEIIGRVSMDQMTIRLPQKYTIGTKVTLIGQQGSCNITTTDVAQKRQTINYEVLCLLSD
RIPRYY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagttatcatagaccaaccagagccttgatagatttagaggcgattgcaaat
aacgttaaatctgtacaagagcacattccaagtgataaaaaaacatttgctgtagttaag
gctaatgcttatgggcatggtgctgttgaagtttcaaaatacattgagtctattgtagat
ggtttttgcgtatccaatttagatgaggctattgagctacgtcaagcaggaattgtaaaa
atgatattggtattaggtgttgttatgcctgagcaggttatactagccaaaaatgaaaat
attactctaacagttgctagcttggagtggttacgtttatgtcagacatcagcagtagat
ttatctggtctagaagtacatatcaaagttgatagtggaatgggacgtataggtgttcgc
cagttagatgaaggaaataagctaatttctgaattgggggaaagtggtgcctctgtcaag
gggattttcacccattttgcaacagctgatgaagccgataactgtaaattcaatcaacaa
cttactttttttaaagactttatttcaggattagataattgtccggaccttgttcatgct
agtaattctgctacaagcctttggcatagtgagacaatttttaatgccgttagattgggt
gttgttatgtacggcttaaatccaagtggaactgatttagacttaccttaccctataaac
cctgctttaagtttagagtctgagctagtacatgttaaacaactacacgatggttctcaa
gttggctatggcgcaacctatcaagttactggagacgaatttgttggaacagtaccgatt
ggctacgctgatggatggacacgagatatgcaaggattttcagttatagtaaatggagaa
ctttgtgaaattattgggcgtgtctcgatggatcaaatgactatccgtttacctcaaaaa
tatactatcggaactaaagtaaccttgattggtcaacaaggtagttgtaacattacaact
acggacgtcgctcaaaaaagacagacgattaattatgaagtactttgtcttttaagcgat
cgtattccgagatattattaa

DBGET integrated database retrieval system