KEGG   Streptococcus agalactiae ILRI005: MSA_9110Help
Entry
MSA_9110          CDS       T02704                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00473  D-Alanine metabolism
sagi00550  Peptidoglycan biosynthesis
sagi01100  Metabolic pathways
sagi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sagi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MSA_9110
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MSA_9110
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MSA_9110
Enzymes [BR:sagi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MSA_9110
Peptidoglycan biosynthesis and degradation proteins [BR:sagi01011]
 Precursor biosynthesis
  Amino acid ligase
   MSA_9110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 RimK GARS_A REC114-like
Motif
Other DBs
NCBI-ProteinID: CCW39772
LinkDB All DBs
Position
789178..790224
Genome map
AA seq 348 aa AA seqDB search
MSKETLILLYGGRSAEREVSVLSAESVMRAINYDKFFVKTYFITQVGQFIKTQEFDEMPS
SDEKLMTNQTVDLDKMVRPSDIYDDNAIVFPVLHGPMGEDGSIQGFLEVLRMPYVGTNIL
SSSVAMDKITTKQVLATVGVPQVAYQTYFEGDDLEHAIKLSLETLSFPIFVKPANMGSSV
GISKATDESSLRSAIDSALKYDSRILIEQGVTAREIEVGILGNNDVKTTFPGEVVKDVDF
YDYDAKYIDNKITMDIPAKVDEGTMEAMRQYASKAFKAIGACGLSRCDFFLTKDGQIFLN
ELNTMPGFTQWSMYPLLWENMGLTYSDLIEKLVMLAKEMFEKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaacattgatcttgctttacggtggtcgctctgcggaacgtgaagtatct
gtactgtctgcagaaagcgtcatgcgtgctattaattatgataaattttttgttaaaact
tattttatcacgcaagtaggtcaatttattaaaacacaagaatttgatgaaatgccatct
tcagatgaaaagttaatgacaaaccaaactgttgatttagacaaaatggttcgtccaagt
gatatctatgatgataatgcaattgttttccccgttttacatggaccaatgggggaagat
ggttctatccaaggatttttagaagttttaaggatgccttatgttgggactaatattcta
tcttcaagcgtggctatggataaaattacaacaaaacaagtccttgcaacagtaggtgta
cctcaggttgcatatcaaacttattttgagggtgatgatttggaacatgcgattaaactc
tctttagaaactttaagtttcccaatttttgtaaaaccggctaatatggggtcatcagta
ggtatttcaaaagcgacagatgaatcctcacttcgctctgcaattgactcagctctcaag
tatgatagccgtattttgattgaacaaggcgtgacagctcgtgaaattgaagtaggtatt
ttaggcaataatgatgttaagacaacttttcctggcgaagttgttaaagacgtcgatttc
tatgactatgacgccaaatatattgataataaaattactatggatattccagctaaagtt
gatgaaggaactatggaagcaatgcgtcaatatgcaagtaaagcttttaaagcaatcggg
gcttgtggtttatcacgctgtgatttctttttgacgaaagatggacaaatcttcttaaac
gaactgaatacaatgcccggtttcactcagtggtcaatgtaccctctgctttgggaaaat
atggggctaacttatagtgatttgattgaaaagttagttatgttagctaaagaaatgttt
gaaaaacgtgagagtcatttaatttaa

DBGET integrated database retrieval system