KEGG   Streptococcus agalactiae 09mas018883: BSA_9680Help
Entry
BSA_9680          CDS       T02703                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sagm  Streptococcus agalactiae 09mas018883
Pathway
sagm00010  Glycolysis / Gluconeogenesis
sagm00020  Citrate cycle (TCA cycle)
sagm00620  Pyruvate metabolism
sagm01100  Metabolic pathways
sagm01110  Biosynthesis of secondary metabolites
sagm01120  Microbial metabolism in diverse environments
sagm01130  Biosynthesis of antibiotics
sagm01200  Carbon metabolism
Module
sagm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sagm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSA_9680
   00020 Citrate cycle (TCA cycle)
    BSA_9680
   00620 Pyruvate metabolism
    BSA_9680
Enzymes [BR:sagm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BSA_9680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl HlyD_3 Biotin_lipoyl_2 PYNP_C
Motif
Other DBs
NCBI-ProteinID: CCW37740
LinkDB All DBs
Position
919608..920996
Genome map
AA seq 462 aa AA seqDB search
MAVEIIMPKLGVDMQEGEILEWKKQVGDVVNEGDVLLEIMSDKTNMEIEAEDSGVLLKIT
HGNGDVVPVTETIGYIGAEGEEVTEASSSENTSVEENATQVTSEPEKVEETSEPSVPAAT
SGEKVRATPAARKLAREMSIDLSLVSGTGANGRVHREDVENFKGAQPRITPLARRIAEDQ
GVDIAEITGSGIRGKIVKNDVLAAMSPQAAEAPVETKATPTTEEKQLPEGVEVIKMSAMR
KAISKGMTNSYLTAPSFTLNYDIDMTEMMALRKKLIDPIMAKTGLKVSFTDLIGMAVVKT
LMKPEHRYLNASLINDAQEIELHNFVNIGIAVGLDDGLIVPVVHNADQMSLSDFVIASKD
VIKKTQEGKLKSAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPTPTVVDGE
IVARPIMAMCLTIDHRIVDGMNGAKFMVDLKNLMENPFGLLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaaattattatgcctaaactcggggttgatatgcaagaaggcgaaatcctt
gagtggaaaaaacaggtaggtgatgttgttaatgaaggtgacgtcctacttgaaattatg
tcagataaaacaaatatggagattgaagcagaagactcaggtgttttactaaaaatcaca
catgggaatggagatgttgttcctgtaactgagacaattggttatattggtgctgaaggt
gaagaagtaacagaagcatcttcttctgaaaatacatcagttgaagaaaacgcgacacaa
gtaacttcagaaccagaaaaagttgaagaaacatcagaaccaagtgtgccagcagctaca
agtggtgaaaaagtacgtgccactcctgcagctcgtaaattagcaagagagatgtctatt
gacctttcactagtatctggaacaggggcaaatggtcgcgttcacagagaagatgttgaa
aacttcaagggtgctcaaccacgtattacaccattggcacgtcgaattgctgaagatcaa
ggagttgatatagcagaaatcactggcagtggtattcgtggtaaaattgttaaaaatgat
gttttggctgctatgtcaccgcaagcagcagaggctcctgtagaaactaaagctacacca
acaacagaagaaaaacaattaccagaaggtgttgaagtcattaagatgtctgcaatgcgt
aaggctatttctaaaggtatgactaactcttacctcactgctccaagctttacacttaac
tatgacattgatatgactgaaatgatggctcttcgcaagaaattaattgatccaatcatg
gctaaaacaggcttgaaagtcagctttactgatttgattggaatggccgttgttaagaca
ttgatgaaaccagagcatcgatacctaaatgcttcattaattaacgatgcacaagaaatt
gagcttcataattttgttaatattggaatcgcagttggtcttgatgatggtttgattgtt
cctgttgttcacaatgctgatcaaatgtcactttctgactttgttatagcatctaaagat
gttattaagaaaactcaagaaggtaaattaaaatcagctgaaatgtcaggttcaacattc
tcaattactaacttaggtatgtttggtactaagacgtttaacccaattatcaatcaaccg
aactcagcaatccttggagtaggagctactattccgactccaacagtggttgatggtgaa
attgtagctcgaccaattatggcaatgtgtttaacaattgaccaccgtattgttgatgga
atgaatggtgctaagtttatggttgatcttaagaacttaatggaaaacccatttggttta
cttatttga

DBGET integrated database retrieval system