KEGG   Streptococcus agalactiae CNCTC 10/84: W903_1675Help
Entry
W903_1675         CDS       T03518                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sagn  Streptococcus agalactiae CNCTC 10/84
Pathway
sagn00473  D-Alanine metabolism
sagn01100  Metabolic pathways
sagn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sagn00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    W903_1675 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    W903_1675 (alr)
Enzymes [BR:sagn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     W903_1675 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:sagn01011]
 Precursor biosynthesis
  Racemase
   W903_1675 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TIG
Motif
Other DBs
NCBI-ProteinID: AIX05345
LinkDB All DBs
Position
complement(1607611..1608711)
Genome map
AA seq 366 aa AA seqDB search
MISSYHRPTRALIDLEAIANNVKSVQEHIPSDKKTFAVVKANAYGHGAVEVSKYIESIVD
GFCVSNLDEAIELRQAGIVKMILVLGVVMPEQVILAKNENITLTVASLEWLRLCQTSAVD
LSGLEVHIKVDSGMGRIGVRQLDEGNKLISELGESGASVKGIFTHFATADEADNCKFNQQ
LTFFKDFISGLDNCPDLVHASNSATSLWHSETIFNAVRLGVVMYGLNPSGTDLDLPYPIN
PALSLESELVHVKQLHDGSQVGYGATYQVTGDEFVGTVPIGYADGWTRDMQGFSVIVNGE
LCEIIGRVSMDQMTIRLPQKYTIGTKVTLIGQQGSCNITTTDVAQKRQTINYEVLCLLSD
RIPRYY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagttatcatagaccaaccagagccttgatagatttagaggcgattgcaaat
aacgttaaatctgtacaagagcacattccaagtgataaaaaaacatttgctgtagttaag
gctaatgcttatgggcatggtgctgttgaagtttcaaaatacattgagtctattgtagat
ggtttttgcgtatccaatttagatgaggctattgagctacgtcaagcaggaattgtaaaa
atgatattggtattaggtgttgttatgcctgagcaggttatactagccaaaaatgaaaat
attactctaacagttgctagcttggagtggttacgtttatgtcagacatcagcagtagat
ttatctggtctagaagtacatatcaaagttgatagtggaatgggacgtataggtgttcgc
cagttagatgaaggaaataagctaatttctgaattgggggaaagtggtgcctctgtcaag
gggattttcacccattttgcaacagctgatgaagccgataactgtaaattcaatcaacaa
cttactttttttaaagactttatttcaggattagataattgtccggaccttgttcatgct
agtaattctgctacaagcctttggcatagtgagacaatttttaatgccgttagattgggt
gttgttatgtacggcttaaatccaagtggaactgatttagacttaccttaccctataaac
cctgctttaagtttagagtctgagctagtacatgttaaacaactacacgatggttctcaa
gttggctatggcgcaacctatcaagttactggagacgaatttgttggaacagtaccgatt
ggctacgctgatggatggacacgagatatgcaaggattttcagttatagtaaatggagaa
ctttgtgaaattattgggcgtgtctcgatggatcaaatgactatccgtttacctcaaaaa
tatactatcggaactaaagtaaccttgattggtcaacaaggtagttgtaacattacaact
acggacgtcgctcaaaaaagacagacgattaattatgaagtactttgtcttttaagcgat
cgtattccgagatattattaa

DBGET integrated database retrieval system