KEGG   Streptococcus agalactiae ILRI112: SAIL_17390Help
Entry
SAIL_17390        CDS       T02705                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sagr  Streptococcus agalactiae ILRI112
Pathway
sagr00473  D-Alanine metabolism
sagr01100  Metabolic pathways
sagr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sagr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SAIL_17390
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SAIL_17390
Enzymes [BR:sagr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SAIL_17390
Peptidoglycan biosynthesis and degradation proteins [BR:sagr01011]
 Precursor biosynthesis
  Racemase
   SAIL_17390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TIG
Motif
Other DBs
NCBI-ProteinID: CCW42751
LinkDB All DBs
Position
complement(1625355..1626455)
Genome map
AA seq 366 aa AA seqDB search
MISSYHRPTRALIDLEAIANNVKSVQEHIPSDKKTFAVVKANAYGHGAVEVSKYIESVVD
GFCVSNLDEAIELRQAGIVKMILVLGVVMPEQVILAKNENITLTVASLEWLRLCQTSAVD
LSGLEVHIKVDSGMGRIGVRQLDEGNKLISELGESGASVKGIFTHFATADEADNCKFNQQ
LTFFKDFISGLDNCPDLVHASNSATSLWHSETIFNAVRLGVVMYGLNPSGTDLDLPYPIN
PALSLESELVHVKQLHDGSQVGYGATYQVTGDEFVGTVPIGYADGWTRDMQGFSVIVNGE
LCEIIGRVSMDQMTIRLPQKYTIGTKVTLIGQQGSCNITTTDVAQKRQTINYEVLCLLSD
RIPRYY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagttatcatagaccaaccagagccttgatagatttagaggcgattgcaaat
aacgttaaatctgtacaagagcacattccaagtgataaaaaaacatttgctgtagttaag
gctaatgcttatgggcatggtgctgttgaagtttcaaaatacattgagtctgttgtagat
ggtttttgtgtatccaatttagatgaggctattgagctacgtcaagcaggaattgtaaaa
atgatattggtattaggtgttgttatgcctgagcaggttatactagccaaaaatgaaaat
attactctaacagttgctagcttggagtggttacgtttatgtcagacatcagcagtagat
ttatctggtctagaagtacatatcaaagttgatagtggaatgggacgtataggtgttcgc
cagttagatgaaggaaataagctaatttctgaattgggggaaagtggtgcctctgtcaag
gggattttcacccattttgcaacagctgatgaagccgataactgtaaattcaatcaacaa
cttactttttttaaagactttatttcaggattagataattgtccggaccttgttcatgct
agtaattctgctacaagcctttggcatagtgagacaatttttaatgccgttagattgggt
gttgttatgtacggcttaaatccaagtggaactgatttagacttaccttaccctataaac
cctgctttaagtttagagtctgagctagtacatgttaaacaactacacgatggttctcaa
gttggctatggcgcaacctatcaagttactggagacgaatttgttggaacagtaccgatt
ggctacgctgatggatggacacgagatatgcaaggattttcagttatagtaaatggagaa
ctttgtgaaattattgggcgtgtctcgatggatcaaatgactatccgtttacctcaaaaa
tatactatcggaactaaagtgaccttgattggtcaacaaggtagttgtaacattacaact
acggacgtcgctcaaaaaagacagacgattaattatgaagtactttgtcttttaagcgat
cgtattccgagatattattaa

DBGET integrated database retrieval system