KEGG   Streptococcus agalactiae ILRI112: SAIL_9120Help
Entry
SAIL_9120         CDS       T02705                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sagr  Streptococcus agalactiae ILRI112
Pathway
sagr00473  D-Alanine metabolism
sagr00550  Peptidoglycan biosynthesis
sagr01100  Metabolic pathways
sagr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sagr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SAIL_9120
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAIL_9120
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SAIL_9120
Enzymes [BR:sagr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SAIL_9120
Peptidoglycan biosynthesis and degradation proteins [BR:sagr01011]
 Precursor biosynthesis
  Amino acid ligase
   SAIL_9120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK REC114-like
Motif
Other DBs
NCBI-ProteinID: CCW41929
LinkDB All DBs
Position
816382..817428
Genome map
AA seq 348 aa AA seqDB search
MSKETLILLYGGRSAEREVSVLSAESVMRAINYDKFFVKTYFITQVGQFIKTQEFDEMPS
SDEKLMTNQTVDLDKMVRPSDIYDDNAIVFPVLHGPMGEDGSIQGFLEVLRMPYVGTNIL
SSSVAMDKITTKQVLATVDVPQVAYQTYFEGDDLEHAIKLSLETLSFPIFVKPANMGSSV
GISKATDESSLRSAIDLALKYDSRILIEQGVTAREIEVGILGNNDVKTTFPGEVVKDVDF
YDYDAKYIDNKITMDIPAKVDEATMEAMRQYASKAFKAIGACGLSRCDFFLTKDGQIFLN
ELNTMPGFTQWSMYPLLWENMGLTYSDLIEKLVMLAKEMFEKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaacattgatcttgctttacggtggtcgctctgcggaacgtgaagtatct
gtactgtctgcagaaagcgtcatgcgtgctattaattatgataaattttttgttaaaact
tattttatcacgcaagtaggtcaatttattaaaacacaagaatttgatgaaatgccatct
tcagatgaaaagttaatgacaaaccaaactgttgatttagacaaaatggttcgtccaagt
gacatctatgatgataatgcaattgttttccccgttttacatggaccaatgggggaagat
ggttctatccaaggatttttagaagttttaaggatgccttatgttgggactaatattcta
tcttcaagtgtggctatggataaaattacaacaaaacaagtccttgcaacagtagatgta
cctcaggttgcatatcaaacttattttgagggtgatgatttggaacatgcgattaaactc
tctttagaaactttaagtttcccaatttttgtaaaaccggctaatatggggtcatcagta
ggtatttcaaaagcgacagatgaatcctcacttcgctctgcaattgacttagctctcaag
tatgatagccgtattttgattgaacaaggcgtgacagctcgtgaaattgaagtaggtatt
ttaggcaataatgatgttaagacaacttttcctggcgaagtcgttaaagacgtcgatttc
tatgactatgacgccaaatatattgataataaaattactatggatattccagctaaagtt
gatgaagcaactatggaagcaatgcgtcaatatgcaagtaaagcttttaaagcaatcggg
gcttgtggtttatcacgctgtgatttctttttgacgaaagatggacaaatcttcttaaac
gaactgaatacaatgcccggttttactcagtggtcaatgtatcctctgctttgggaaaat
atggggctaacttatagtgatttgattgaaaagttagttatgttagctaaagaaatgttt
gaaaaacgtgagagtcatttaatttaa

DBGET integrated database retrieval system