KEGG   Streptococcus agalactiae COH1: GBSCOH1_0686Help
Entry
GBSCOH1_0686      CDS       T03434                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sagt  Streptococcus agalactiae COH1
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sagt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBSCOH1_0686
  Energy metabolism
   00680 Methane metabolism
    GBSCOH1_0686
Enzymes [BR:sagt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GBSCOH1_0686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
715133..717928
Genome map
AA seq 931 aa AA seqDB search
MSHPKLESSSNKEIITEEVGLLKQLLDEATQKLIGSESFDKIEKIVSLSSTDDYTGLKET
ISALSNEEMVIVSRYFSILPLLINISEDVDLAYEINYKNNLNQDYLGKLSTTIDVVAGHE
NAKDILEHVNVVPVLTAHPTQVQRKTVLELTSKIHDLLRKYRDVKAGIVNQEKWYADLRR
YIGIIMQTDTIREKKLKVKNEITNVMEYYNRSLIKAVTKLTAEYKALAAKKGIHLENPKP
LTMGMWIGGDRDGNPFVTAETLRLSAMVQSEVIINHYIEQLNELYRNMSLSISLTEVSPE
LVTLANQSQDNSVYRENEPYRKAFNFIQDKLVQTLLNLKVGSYPKEKFVSRQESSGIVGR
YIKSHIAQVASDIQTEELPAYATAEEFKQDLLLVKQSLVQHGQDSLVDGELACLIQAVDI
FGFYLATIDMRQDSSINEACVAELLKSANIVDDYSSLSEEEKCQLLLKELTEDPRTLSST
HTPKSELLQKELAIFQTARELKDQLGEDIIKQHIISHTESVSDMFELAIMLKEVGLIDAN
QARIQIVPLFETIEDLDNSRDIMTQYLHYGLVKKWITTNNNYQEIMLGYSDSNKDGGYLS
SGWTLYKAQNELTKIGEENGIKITFFHGRGGTVGRGGGPSYEAITSQPFGSIKDRIRLTE
QGEIIENKYGNQDAAYYNLEMLISASIDRMVTRMITNLNEIDNFRETMDGIVAESNAVYR
NLVFDNPYFYDYFFEASPIKEVSSLNIGSRPAARKTITEISGLRAIPWVFSWSQNRIMFP
GWYGVGSAFKQFIEQDEANLAKLQTMYQKWPFFNSLLSNVDMVLSKSNMNIALQYAQLAG
SKEVRDVFNIILNEWQLTKDMILAIEQHDNLLEENPMLHASLDYRLPYFNVLNYVQIELI
KRLRSNQLDEDYEKLIHITINGIATGLRNSG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccacccgaaattagaaagtagtagcaataaagaaatcattaccgaagaggtcggt
ttactgaagcagcttttggatgaagcaacgcaaaaattgattggtagtgaatcatttgac
aagattgaaaaaatagtttcattatcatcaactgacgattatactggtttgaaggaaact
atttcggctttaagcaacgaggagatggttattgtttctcgttacttctctattttgccg
ctcttaattaatatttcagaagacgttgatttagcatatgaaattaattataaaaataat
cttaaccaagattacctaggaaagttatcaacgactattgatgttgtagctggccatgaa
aatgctaaagatattcttgaacacgtcaatgttgtgcctgtgctaacagctcatcctact
caggtgcagcgtaaaacggtgctcgaattaacgtctaagattcatgatttattacgtaaa
tacagagatgtcaaagcaggaatcgtgaatcaagaaaaatggtatgctgacttgcgtcgt
tacatcggcattatcatgcaaacagacactattcgcgagaaaaaattgaaagtcaaaaat
gagataaccaatgtaatggaatattacaaccgttctcttattaaagcagttaccaaatta
acagcagaatataaggcactggcagctaaaaaaggtattcacttagagaatcctaagcct
ctgactatggggatgtggattggtggtgatagagatggcaatccctttgtaactgctgag
acactaagattatcagctatggtacaaagtgaagtgattattaaccattatattgagcag
ctaaatgaactttatcgtaatatgtcactttcaataagtctaactgaagtctctcccgaa
cttgttacgttggcaaaccagtcacaagataattcagtatatagggaaaatgaaccttat
cgtaaagctttcaattttatccaagataaactagtacaaaccctactaaatttaaaagtt
ggttcttacccaaaagagaaatttgttagtcgccaagaatcttctggtattgtaggaagg
tatataaaatcacatatcgctcaagtagcttctgacatacagacagaagaactaccagca
tacgctactgctgaggagtttaaacaagatttgttacttgtgaagcaatctttagttcaa
catggacaagattctcttgtcgatggcgaattagcttgtcttattcaagcagtagatatc
tttggattttatttagctactattgatatgcgtcaagattctagtattaatgaagcttgt
gtagcagaattattgaagtctgccaatattgtagatgattacagttctctttcagaagaa
gaaaaatgtcaacttctcttaaaagaattaacagaagatcctagaacattatcttctacg
catactcctaaatccgagttacttcaaaaagaattggctattttccaaacagcacgtgag
ttaaaagatcaattgggtgaagacattataaaacagcatatcatttctcacacagagagc
gtttcggatatgtttgagttagctatcatgttaaaagaagttggactaattgatgccaat
caagctcgcattcagattgtaccgttatttgaaaccatcgaagatttggataattcacgt
gatattatgacccagtatctacattatggattagtaaaaaaatggattacaactaacaac
aattatcaagaaataatgctaggttattcagatagtaataaagatggtggctatttatca
tctggttggactctatataaagctcaaaatgagctaacaaaaataggtgaagaaaacggt
attaaaatcacatttttccacggtcgtggtggaactgttggtcgtggtggtggtccatct
tatgaagctatcacatcacaaccttttggttcaatcaaagatcgaattcgcctaacagag
caaggtgaaatcattgagaataaatatggtaatcaagatgcagcctattataaccttgaa
atgcttatttcagcttccatagaccgcatggtaacacgtatgattactaaccttaatgaa
attgataatttccgtgagacaatggatggtattgtggctgaaagtaatgccgtttataga
aatttagtttttgataatccttatttctatgactatttctttgaagcaagtccaattaaa
gaggtatcaagtttaaatattggttctcggccagcagcacgtaaaacaattacagaaatt
tcaggtttacgtgcaattccatgggtattttcatggtcacaaaatcgtattatgtttccg
ggttggtatggtgttgggtcagccttcaagcaatttattgaacaagatgaggcaaactta
gcaaaattacaaaccatgtatcaaaaatggccattctttaattctcttttatctaatgta
gatatggttttatcaaaatcaaatatgaatattgcgcttcagtatgctcagttagctgga
agtaaagaagttcgagatgtttttaatatcatccttaatgaatggcagttaactaaagat
atgattttagctattgaacagcatgataatttattagaagaaaacccaatgttacatgca
agtttagattatcgtttgccatatttcaatgttttgaattatgttcaaattgaattgatt
aaacgtcttcgtagtaaccaactagatgaagactatgagaagttgattcatattactatt
aatggtattgcaacaggtttacgaaattcaggttaa

DBGET integrated database retrieval system