KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1003Help
Entry
SAK_1003          CDS       T00278                                 

Definition
(GenBank) acetoin dehydrogenase, TPP-dependent, E2 component, dihydrolipoamide S-acetyltransferase, putative
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak00010  Glycolysis / Gluconeogenesis
sak00020  Citrate cycle (TCA cycle)
sak00620  Pyruvate metabolism
sak01100  Metabolic pathways
sak01110  Biosynthesis of secondary metabolites
sak01120  Microbial metabolism in diverse environments
sak01130  Biosynthesis of antibiotics
sak01200  Carbon metabolism
Module
sak_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAK_1003
   00020 Citrate cycle (TCA cycle)
    SAK_1003
   00620 Pyruvate metabolism
    SAK_1003
Enzymes [BR:sak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SAK_1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl HlyD_3 Biotin_lipoyl_2 PYNP_C PLA2_B
Motif
Other DBs
NCBI-ProteinID: ABA45151
LinkDB All DBs
Position
965749..967137
Genome map
AA seq 462 aa AA seqDB search
MAVEIIMPKLGVDMQEGEILEWKKQVGDVVNEGDVLLEIMSDKTNMEIEAEDSGVLLKIT
HGNGDVVPVTETIGYIGAEGEEVTEASSSENTSVEENATQVTSEPEKVEETSEPSVPAAT
SGEKVRATPAARKLAREMSIDLALVSGTGANGRVHREDVENFKGAQPRITPLARRIAEDQ
GVDIAEITGSGIRGKIVKNDVLAAMSPQAAEAPVETKATPTTEEKQLPEGVEVIKMSAMR
KAISKGMTNSYLTAPSFTLNYDIDMTEMMALRKKLIDPIMAKTGLKVSFTDLIGMAVVKT
LMKPEHRYLNASLINDAQEIELHNFVNIGIAVGLDDGLIVPVVHNADQMSLSDFVIASKD
VIKKTQEGKLKSAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPTPTVVDGE
IVARPIMAMCLTIDHRIVDGMNGAKFMVDLKNLMENPFGLLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaaattattatgcctaaactcggggttgatatgcaagaaggcgaaatcctt
gagtggaaaaaacaggtaggtgatgttgttaatgaaggtgacgtcctacttgaaattatg
tcagataaaacaaatatggagattgaagcagaagactcaggtgttttactaaaaatcaca
catgggaatggagatgttgttcctgtaactgagacaattggttatattggtgctgaaggt
gaagaagtaacagaagcatcttcttctgaaaatacatcagttgaagaaaacgcgacacaa
gtaacttcagaaccagaaaaagttgaagaaacatcagaaccaagtgtgccagcagctaca
agtggtgaaaaagtacgtgccactcctgcagctcgtaaattagcaagagagatgtctatt
gaccttgcactagtatctggaacaggggcaaatggtcgcgttcacagagaagatgttgaa
aacttcaagggtgctcaaccacgtattacaccattggcacgtcgaattgctgaagatcaa
ggagttgatatagcagaaatcactggcagtggtattcgtggtaaaattgttaaaaatgat
gttttggctgctatgtcaccgcaagcagcagaggctcctgtagaaactaaagctacacca
acaacagaagaaaaacaattaccagaaggtgttgaagtcattaagatgtctgcaatgcgt
aaggctatttctaaaggtatgactaactcttacctcactgctccaagctttacacttaac
tatgacattgatatgactgaaatgatggctcttcgcaagaaattaattgatccaatcatg
gctaaaacaggcttgaaagtcagctttactgatttgattggaatggccgttgttaagaca
ttgatgaaaccagagcatcgatacctaaatgcttcattaattaacgatgcacaagaaatt
gagcttcataattttgttaatattggaatcgcagttggtcttgatgatggtttgattgtt
cctgttgttcacaatgctgatcaaatgtcactttctgactttgttatagcatctaaagat
gttattaagaaaactcaagaaggtaaattaaaatcagctgaaatgtcaggttcaacattc
tcaattactaacttaggtatgtttggtactaagacgtttaacccaattatcaatcaaccg
aactcagcaatccttggagtaggagctactattccgactccaacagtggttgatggtgaa
attgtagctcgaccaattatggcaatgtgtttaacaattgaccaccgtattgttgatgga
atgaatggtgctaagtttatggttgatcttaagaacttaatggaaaacccatttggttta
cttatttga

DBGET integrated database retrieval system