KEGG   Streptomyces albus J1074: XNR_1523Help
Entry
XNR_1523          CDS       T02545                                 

Definition
(GenBank) Alpha-ketoglutarate decarboxylase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
salb  Streptomyces albus J1074
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XNR_1523
  Amino acid metabolism
   00310 Lysine degradation
    XNR_1523
   00380 Tryptophan metabolism
    XNR_1523
Enzymes [BR:salb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     XNR_1523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1808867..1812646
Genome map
AA seq 1259 aa AA seqDB search
MSPQSPSNSSVSTDQAGQGKSPAAAFGSNEWLVDEIYQQYLQDPNSVDRAWWDFFADYKP
GGGGTAPVETAAPSAATPVAPAKPAPAAKAPEAKPAAAPAKPAEQAPAAKAAPAKTAPAK
AAPAKPAAKAAEPAAPAEGPEFVTLRGPSAAVAKNMSASLELPTATSVRAVPVKLLFDNR
IVINNHLKRARGGKISFTHLIGYAMVQAIKAMPSMNNSFAQKDGKPTLVKPEHINLGLAI
DLVKPNGDRQLVVAAIKKAETLNFFEFWQAYEDIVRRARDNKLTMDDFSGVTVSLTNPGG
IGTVHSVPRLMPGQSVILGVGAMEYPAEFQGTSQDTLNKLGISKVMTLTSTYDHRVIQGA
ASGEFLRIVANLLLGENEFYDDIFKALRIPYEPVRWLKDIDASHDDDVTKAARVFELIHS
YRVRGHVMADTDPLEYHQRKHPDLDINEHGLTLWDLERTFAVGGFAGKSMMKLRDILGVL
RDSYCRTTGIEFMHIQDPKQRKWIQDRVERGPGKPEREEQLRILRRLNSAEAFETFLQTK
YVGQKRFSLEGGESVIPLLDAVLDSAAEARLDEVVVGMAHRGRLNVLANIVGKSYAQIFR
EFEGNLDPKSMHGSGDVKYHLGAEGTFTGLDGEQIKVSLTANPSHLEAVDPVMEGVVRAK
QDIINKGGTDFTVLPVALHGDAAFAGQGVVAETLNMSQLRGYRTGGTVHIVINNQVGFTA
APESSRSSMYATDVARMIEAPIFHVNGDDPEAVVRVGRLAFEFRQAFNKDVVIDLICYRR
RGHNESDNPAFTQPLMYDLIDKKRSVRKLYTESLIGRGDITLEEAEQALQDFQGQLEKVF
TEVREATSHPVEHEPEGPEAEFPVTVNTAVSPEVVKRIAESQVNIPERVTVHPRLLPQLQ
RRAAMVEDGTIDWGMGETLAIGSLLMEGTPVRLSGQDSRRGTFGQRHAVLIDRETGDDYT
PLLYLSDNQARYNIYDSLLSEYAAMGFEYGYSLARPESLVLWEAQFGDFVNGAQTVVDEF
ISSAEQKWSQHSGVTLLLPHGYEGQGPDHSSARPERFLQLCAQNNMTVAMPTLPSNYFHL
LRWQVHNPHHKPLVVFTPKSMLRLKAAASKAEEFTTGGFRPVIGDDSVDASQVRKVVLCA
GKVYYDLEAERQKRGVTDTAIIRVERLYPLPGAELQAEIAKYPNAEKFLWAQEEPANQGF
WPFIALNLIDHLDLGVGADLPAAERLRRISRPHSSSPAVGSAKRHQAEQAQLVAEVFDA
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccacagtcccccagtaattcgagcgtctcgaccgaccaagcggggcagggcaag
agtcctgccgccgcgttcgggtcgaacgagtggctcgtcgacgagatctaccagcagtac
ctccaggacccgaactcggtagaccgagcctggtgggacttcttcgccgactacaagccc
ggcgggggtggcacggctcccgtggagaccgcagccccctcggccgcgaccccggtcgcg
ccggccaagcccgctccggcggccaaggcccccgaggcgaagccggctgccgcgccggcc
aagcccgccgagcaggcgccggccgccaaggccgcccccgcgaagacggcccccgccaag
gccgctccggccaagcccgccgcgaaggccgccgagcctgccgcgcccgcggaaggcccg
gagttcgtcacgctgcgtggcccctcggccgcggtcgcgaagaacatgagcgcctcgctg
gagctgcccacggccacgtccgtgcgcgcggtgccggtcaagctcctcttcgacaaccgc
atcgtcatcaacaaccacctgaagcgcgcccggggcgggaagatctccttcacgcacctg
atcggctacgccatggtgcaggccatcaaggccatgccgtcgatgaacaactccttcgcg
cagaaggacggcaagccgacgctggtcaagcccgagcacatcaacctcgggctcgccatc
gacctggtcaagcccaacggcgaccgccagctcgtcgtcgcggccatcaagaaggccgag
accctcaacttcttcgagttctggcaggcgtacgaggacatcgtccgccgggcccgggac
aacaagctgacgatggacgacttctcgggcgtcaccgtctcgctgaccaaccccggcggc
atcggcaccgtccactcggtgccgcgtctgatgcccggccagtcggtgatcctcggcgtg
ggcgcgatggagtacccggcggagttccagggcacctcgcaggacaccctgaacaagctc
ggcatctcgaaggtcatgaccctgacgtcgacctacgaccaccgggtcatccagggcgcc
gcctccggcgagttcctgcggatcgtcgccaacctgctgctcggcgagaacgagttctac
gacgacatcttcaaggcgctgcgcatcccctacgagccggtccgctggctcaaggacatc
gacgcctcgcacgacgacgacgtcaccaaggccgcccgcgtcttcgagctgatccactcc
taccgggtccgcggccacgtcatggccgacaccgacccgctcgagtaccaccagcgcaag
caccccgacctcgacatcaacgagcacgggctcacgctgtgggacctggagcgcaccttc
gccgtcggcggcttcgccggcaagtcgatgatgaagctccgcgacatcctcggcgtcctg
cgcgactcgtactgccgcaccaccggcatcgagttcatgcacatccaggacccgaagcag
cgcaagtggatccaggaccgggtggagcgcggtccgggcaagcccgagcgcgaggagcag
ctgcgcatcctgcggcggctcaacagcgccgaggcgttcgagaccttcctgcagaccaag
tacgtcggccagaagcggttctcgctggagggcggcgagtccgtcatcccgctgctcgac
gcggtcctggactcggcggccgaggcgcggctggacgaggtcgtcgtcggcatggcccac
cgcggccgcctcaacgtcctcgccaacatcgtcggcaagtcgtacgcgcagatcttccgg
gagttcgagggcaacctcgacccgaagtcgatgcacggctccggcgacgtcaagtaccac
ctgggcgccgagggcaccttcaccggcctggacggcgagcagatcaaggtctcgctcacc
gccaacccctcccacctggaggcggtcgacccggtcatggagggcgtggtccgcgccaag
caggacatcatcaacaagggcggcacggacttcaccgtcctgcccgtcgccctccacggt
gacgcggccttcgcgggccagggcgtggtggccgagacgctcaacatgtcgcagctgcgc
ggctaccgcaccggcggcacggtccacatcgtcatcaacaaccaggtcggcttcaccgcc
gcgccggagtcctcgcgctcctcgatgtacgccaccgacgtggcgcgcatgatcgaggcg
ccgatcttccacgtgaacggtgacgacccggaggccgtcgtccgcgtcggacggctcgcc
ttcgagttccgccaggcgttcaacaaggacgtcgtcatcgacctgatctgctaccgccgc
cgcggccacaacgagtcggacaacccggccttcacccagccgctgatgtacgacctgatc
gacaagaagcgctcggtgcgcaagctctacaccgagtcgctgatcggccggggcgacatc
accctcgaagaggcggagcaggcgctccaggacttccagggccagctggagaaggtcttc
accgaggtccgcgaggccacctcgcacccggtggagcacgagccggagggccccgaggcg
gagttcccggtcacggtcaacaccgcggtctccccggaggtcgtcaagcggatcgccgag
tcgcaggtcaatatccccgagcgggtcaccgtccacccccgtctgctgccgcagctccag
cgccgcgcggcgatggtcgaggacggcacgatcgactggggcatgggcgagaccctggcc
atcggctcgctgctgatggagggcaccccggtgcgcctctccggccaggactcgcgccgc
ggcaccttcggccagcgccacgcggtcctcatcgaccgggagaccggcgacgactacacg
ccgctgctgtacctctcggacaaccaggcccgctacaacatctacgactcgctgctctcc
gagtacgcggcgatgggcttcgagtacggctactcgctggcccgtccggagtcgctggtg
ctgtgggaggcccagttcggtgacttcgtcaacggcgcgcagaccgtcgtcgacgagttc
atctcctcggccgagcagaagtggagccagcactccggtgtgacgctgctgctgccgcac
ggctacgagggccagggcccggaccactcctcggcccgcccggagcggttcctccagctc
tgcgcgcagaacaacatgacggtcgccatgccgaccctcccgtcgaactacttccacctc
ctgcggtggcaggtgcacaacccgcaccacaagccgctggtggtcttcacgccgaagtcg
atgctgcgcctgaaggccgccgcgtcgaaggcggaggagttcacgacgggcggcttccgc
ccggtcatcggcgacgactcggtggacgcctcgcaggtccgcaaggtcgtcctctgcgcc
ggcaaggtctactacgacctggaggcagagcggcagaagcgcggcgtcacggacaccgcg
atcatccgcgtcgagcgcctgtacccgctgccgggtgccgagctccaggcggagatcgcc
aagtacccgaacgccgagaagttcctgtgggcccaggaggagccggcgaaccagggcttc
tggccgttcatcgcgctcaacctgatcgaccacctggacctgggtgtcggcgcggacctc
ccggcggccgagcggctgcggcgcatctcgcgtccgcactcctcgtccccggcggtcggt
tcggccaagcgccaccaggccgagcaggcccagctggtcgccgaggtcttcgacgcctga

DBGET integrated database retrieval system