KEGG   Streptomyces albulus ZPM: SAZ_04695Help
Entry
SAZ_04695         CDS       T03896                                 

Definition
(GenBank) peptidase S1
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
sall  Streptomyces albulus ZPM
Brite
Enzymes [BR:sall01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     SAZ_04695
Peptidases [BR:sall01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   SAZ_04695
Exosome [BR:sall04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAZ_04695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1030468..1031271
Genome map
AA seq 267 aa AA seqDB search
MAGAWLRGGAAAAAVFEAVCGAVLAAVPTATAMAGRPVPDTRIVGGGNADVRDVPWQVSL
RNRGGHICGGSIVRSDAVVTAAHCTVGAPPGSLSVRAGSAARGSGGQVVRVARVLRHPKY
DAATIDYDVAVLVLASPLRFGDGVRAVPLVPAGSEPSAGTPATVTGWGATRDGGALPERL
RRVDVPKLSDAYCKGAYGPSSITPRMTCYGYQEGRKDACQGDSGGPLVVDGRLAGIASWG
SGCAAPGHPGVYTKVSDPAIHDYITQS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggcatggctgcggggcggggcggcggcggccgcggtgttcgaggcggtgtgc
ggggctgtgctggccgccgttccgacggcgacggcgatggcgggccggccggtgccggac
acccgcatcgtcggcggggggaacgcggacgtgcgggacgtgccgtggcaggtgtcgctg
cgcaaccgcgggggccacatctgcggcggttcgatcgtccgctccgatgcggtggtgacc
gcggcccactgcaccgtgggggcgccaccggggtcactgagcgtccgggcgggcagcgcc
gcccgtggttcgggcgggcaggtggtccgggtggcccgggtgttgcggcacccgaagtac
gacgccgccacgatcgactacgacgtggcggtgctggtcctggcgtccccgctccggttc
ggtgacggggtgcgggcggtcccgttggtgccggcgggcagcgagccctcggcgggcacc
ccggcgacggtcaccggttggggcgcgacccgggacggcggcgcgttgccggagcggctg
cggcgggtcgacgtgcccaagctcagcgacgcctactgcaagggcgcctacgggccgtcc
tcgatcaccccgcggatgacgtgctacggctaccaggagggccgcaaggacgcctgccag
ggcgacagcggagggccgctggtggtggacggccgcctggcgggcatcgcgtcgtggggc
tcagggtgcgccgcgccggggcacccgggggtctacaccaaggtcagcgatccggcgatc
cacgactacatcacgcagtcgtag

DBGET integrated database retrieval system