KEGG   Streptomyces albulus ZPM: SAZ_26715Help
Entry
SAZ_26715         CDS       T03896                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
sall  Streptomyces albulus ZPM
Pathway
sall00020  Citrate cycle (TCA cycle)
sall00270  Cysteine and methionine metabolism
sall00620  Pyruvate metabolism
sall00630  Glyoxylate and dicarboxylate metabolism
sall00680  Methane metabolism
sall01100  Metabolic pathways
sall01110  Biosynthesis of secondary metabolites
sall01120  Microbial metabolism in diverse environments
sall01130  Biosynthesis of antibiotics
sall01200  Carbon metabolism
Module
sall_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sall_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sall_M00012  Glyoxylate cycle
sall_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sall00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAZ_26715
   00620 Pyruvate metabolism
    SAZ_26715
   00630 Glyoxylate and dicarboxylate metabolism
    SAZ_26715
  Energy metabolism
   00680 Methane metabolism
    SAZ_26715
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAZ_26715
Enzymes [BR:sall01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SAZ_26715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N RHH_3
Motif
Other DBs
NCBI-ProteinID: AKA05621
LinkDB All DBs
Position
6050600..6051589
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVKLRLLEIPQGLKAAEGTAMELDD
CAFPLLQGIDITDDPNVAFAGANVALLVGARPRTKGMERGDLLEANGGIFKPQGKAINDH
AADDIKVLVVGNPANTNALIAQAAAPDVPRERFTAMTRLDHNRALTQLAKKTGTPVSEIS
RLTIWGNHSATQYPDVFHATVAGKNAAEVVNDEKWLADTFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVHTWVNGTADGDWTSMGIPSDGSYGVPEGLISSFPVTTKDGTYEIVQGLE
INEFSRTRIDASVQELVEERDAVRALGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtcaacgtcaccgtcaccggcgccgccggccagatcggttacgcc
ctcctcttccgcatcgcctccggtcagctgctcggcgcggacgtgccggtcaagctgcgc
ctcctggagatcccgcagggcctcaaggccgccgagggcaccgcgatggagctggacgac
tgcgccttcccgctgctccagggcatcgacatcaccgacgacccgaacgtggccttcgcc
ggcgccaacgtcgccctgctcgtgggcgcccgcccccgcaccaagggcatggagcgcggc
gacctgctggaggccaacggcggcatcttcaagccgcagggcaaggccatcaacgaccac
gccgcggacgacatcaaggtcctggtcgtcggcaaccccgccaacaccaacgcgctgatc
gcccaggccgccgccccggacgtgccgcgcgagcgcttcaccgcgatgacccgcctggac
cacaaccgcgcgctgacccagctcgccaagaagaccggcaccccggtgtccgagatcagc
cgcctgaccatctggggcaaccactcggccacccagtacccggacgtcttccacgccacg
gtcgccggcaagaacgccgccgaggtcgtgaacgacgagaagtggctggccgacaccttc
atcccgaccgtcgccaagcgcggcgcggcgatcatcgaggcccgcggcgcgtcctcggcc
gcctcggccgccaacgccgccatcgaccacgtccacacctgggtcaacggcaccgccgac
ggcgactggacctccatgggcatcccctcggacggctcctacggcgtcccggagggcctg
atctcctccttccccgtcaccaccaaggacggcacgtacgagatcgtccagggcctggag
atcaacgagttctcccgcacgcgcatcgacgcctccgtccaggagctggtcgaggagcgc
gacgcggtccgcgcgctcggcctgatctga

DBGET integrated database retrieval system