KEGG   Streptomyces albulus ZPM: SAZ_33310Help
Entry
SAZ_33310         CDS       T03896                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sall  Streptomyces albulus ZPM
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sall00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SAZ_33310
   00650 Butanoate metabolism
    SAZ_33310
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAZ_33310
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAZ_33310
Enzymes [BR:sall01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SAZ_33310
Amino acid related enzymes [BR:sall01007]
 Aminotransferase (transaminase)
  Class III
   SAZ_33310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
7582840..7584153
Genome map
AA seq 437 aa AA seqDB search
MTSDAASLHARHQAVMPSWLSLYYDRPLELTHGEGRHVWDADGTRYLDFFGGILTTMTAH
ALPEVTKAISEQAGRLLHSSTLYLSRPMVELAERIAALSGIPDARVFFTTSGTEANDAAL
LLATTHRRSNQILAMRNSYHGRSFSTVGITGNQSWSPTSLSPLQTLYVHGGVRSRGPYAD
LDDAAYTAACVADLEDVLQQAAGGVAALIAEPVQGVGGFTAPPDGLYAAFREVLAREGIL
WISDEVQTGWGRTGEHFWGWQAHGENGPPDLLTFAKGIGNGMSIGGVVARAEIMNCLPAN
SISTFGGSPITMAAGLANLTYLLEHDLQGNARRVGGLLIERLRAVTAGLDMVREVRGRGL
MIGVELVRPGTDEPSPEAATGVLEAARERGLLVGKGGRGGASLRIAPPLTLTVAEAEHGA
ELLADALRWTRANLAPR
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtccgacgccgcaagcctgcacgcccgccaccaggccgtcatgccgtcctggttg
agcctctactacgaccgccccctggagctcacccacggcgagggccggcacgtctgggac
gccgacggcacgcgctacctcgacttcttcggcggcatcctcaccacgatgaccgcgcac
gccctgcccgaggtcaccaaggcgatcagcgagcaggccggccgtctcctgcactcctcc
acgctgtacctctcccgccccatggtggagttggcggagcggatcgccgcgctctccggc
atccccgacgcccgggtcttcttcaccacctccggcaccgaggccaacgacgccgcactg
ctcctggccaccacccaccgccggtccaaccagatcctggcgatgcgcaacagctaccac
ggccgttccttctccaccgtcggcatcaccggcaaccagagctggtcacccaccagcctc
tcgccgctgcagaccctctacgtccacggcggggtccgctcccgcggcccctacgccgac
ctcgacgacgccgcgtacaccgcggcctgcgtcgccgacctggaggacgtgctccagcag
gccgcgggcggcgtcgccgcgctgatcgccgaaccggtgcagggcgtcggcggcttcacc
gcaccgccggacgggctgtacgcggcgttccgcgaagtcctggcccgcgaggggatcctg
tggatcagcgacgaggtgcagaccggctggggccgcaccggcgagcacttctggggctgg
caggcgcacggcgagaacggcccgccggacctgctcaccttcgccaagggcatcggcaac
ggcatgtccatcggcggggtggtggcccgcgccgagatcatgaactgcctgcccgccaac
tccatctcgaccttcggcggcagcccgatcaccatggccgccggcctggccaacctcacc
tacctcctggagcacgacctccagggcaacgcccggcgggtcggcggactgctcatcgag
cgcctgcgggcggtgaccgccggcctcgacatggtgcgggaggtgcgcgggcggggcctg
atgatcggagtcgagctggtccggccgggcaccgacgagccgtccccggaggcagccacc
ggagtgctggaggccgcgcgggaacgcgggctgctggtcggcaagggcggccggggcggc
gcctcgctccgcatcgccccgccgctcacactcaccgtcgccgaggcggagcacggtgcc
gaactgctcgcggacgccctgcggtggacgcgggcgaacctcgcaccgcgctga

DBGET integrated database retrieval system