KEGG   Streptomyces albulus ZPM: SAZ_33760Help
Entry
SAZ_33760         CDS       T03896                                 

Definition
(GenBank) neuraminidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
sall  Streptomyces albulus ZPM
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sall00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SAZ_33760
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAZ_33760
Enzymes [BR:sall01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SAZ_33760
Bacterial toxins [BR:sall02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SAZ_33760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(7679500..7681437)
Genome map
AA seq 645 aa AA seqDB search
MTSDLRAHPLPRRRPRRRRAPSAVAALTVAALTALATAPARAATDAPSGGFAQQVLFKAA
HEKGYACFRIPAIVRTVRGTLLAFAEGRVHDCGDAGDIDLVLKRSTDGGRTWGPLEVVNH
GDGDTHGNPAPLVDRRTGRIVLAETYNKGRTDGLSCDVPCDRTPHLQYSDDDGATWSAPR
DLTRSIRPRRWNSWYATGPVHGIQLAHGRHAGRLVFGVNAESYAGNRITANHAALVHSDD
GGTTWKVGALDSWPIAPDGTFRQKPSEMTLLERSDGSLYVNGRDQDGTDLGNRTAAVSRD
GGDTFTTPFRAIPDLYAPMVQASALRLPRSTAAGGSGRTLLAAPADPDRRRTMTIRSSYD
EGRTWEGVDRGAQVTTDWSGYSDLVAISPTVTGLLYEGGAADARDEIRFARFTEQWLGPR
RGPDPTTPDRARGARPALVLGGARLTDGPFGRALSFDGTDDAVRLPYRDALPLGRADFTC
TLWFRYRATTGEQPLLWMGGVGSRAPQVAVEGDPAHGRITARLTAVDGARPPATAQVSGV
GAANDGKWHHVAVRRAGGRLLLTVDGTATTSTADVPGSVSRTTTFGVHLGQRPDGRAQFT
GALAEVRVYRRALTDAELSRVRVDDASVAGPLVLGLPLDRVAGGR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcagatctccgcgcgcaccccctcccccgccgcagaccccggcgccgccgcgcc
ccgtccgccgtcgccgcgctcaccgtcgccgcgctcaccgccctggcgaccgcgcccgcc
cgggccgccaccgacgccccgtcgggcggcttcgcgcagcaggtcctcttcaaggcggcc
cacgagaagggctacgcgtgcttccgtatacccgccatcgtgcgaaccgtccgcggcacc
ctgctcgccttcgccgagggccgggtgcacgactgcggggacgccggcgacatcgacctg
gtcctcaagcgctccaccgacggcggccggacctggggcccgctggaggtcgtcaaccac
ggcgacggcgacacccacggcaacccggcaccgctggtggaccgccgcaccggtcggatc
gtcctcgccgagacctacaacaagggccgcaccgacggcctcagttgcgacgtcccctgc
gaccgcaccccgcacctccagtacagcgacgacgacggcgccacctggtccgccccccgc
gacctgacccgcagcatccgcccgcgccggtggaactcctggtacgccaccgggccggtg
cacggcatccagctcgcccacggacggcacgcggggcggctggtcttcggcgtcaacgcc
gagagctacgcgggcaaccggatcaccgccaaccacgccgccctcgtccacagcgacgac
gggggcaccacctggaaggtcggcgcactggacagctggccgatcgcaccggacggcacc
ttccggcagaagccgtcggagatgaccctcctggagcgctccgacggctcgctctacgtc
aacggccgcgaccaggacggcaccgacctcggcaaccgcaccgccgcggtcagccgggac
ggcggcgacaccttcaccacccccttccgcgccatccccgacctctacgccccgatggtg
caggcgtcggcgctgcgcctgccccgctcgaccgccgccggcgggtccggccgcaccctg
ctcgccgcccccgccgaccccgaccgacgccggacgatgaccatccggtcctcctacgac
gagggccgcacctgggagggcgtggaccggggcgcccaggtcaccaccgactggtccggg
tactccgacctggtcgcgatctcccccaccgtcaccggcctgctctacgagggcggtgcc
gccgacgcccgggacgagatccgcttcgcccgcttcaccgagcagtggctcggaccgcgc
cgcggcccggacccgaccacgcccgaccgggcccgcggcgcccggccggcgctggtgctc
ggcggggcccggctcaccgacggcccgttcggccgcgccctgtccttcgacggcaccgac
gacgcggtgcgcctgccctaccgcgatgcgctcccgctgggccgcgcggacttcacctgc
accctgtggttccgctaccgcgccaccaccggcgaacaaccgctgctgtggatgggcggc
gtgggcagccgggccccgcaggtcgccgtcgagggcgatccggcgcacggccggatcacc
gcgcggctgacggccgtcgacggcgcccggccgccggccaccgctcaggtctccggcgtc
ggagccgccaacgacgggaagtggcaccacgtcgcggtgcgccgggcgggcggccggctg
ctgctgaccgtggacggcaccgcgacgaccagcaccgccgacgtccccgggtcggtcagc
cggaccacgacgttcggcgtgcacctgggccagcggccggacggccgggcccagttcacc
ggggcgctggcggaggtccgcgtctaccgacgggccctgaccgacgccgagctctcccgg
gtgcgcgtcgacgacgcgtcggtggccggcccgttggtgctcgggctgccgctggaccgg
gtggcgggcggccgctga

DBGET integrated database retrieval system