KEGG   Streptomyces albulus ZPM: SAZ_40295Help
Entry
SAZ_40295         CDS       T03896                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sall  Streptomyces albulus ZPM
Pathway
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Two-component system
Brite
KEGG Orthology (KO) [BR:sall00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SAZ_40295
   00790 Folate biosynthesis
    SAZ_40295
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAZ_40295
Enzymes [BR:sall01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SAZ_40295
Exosome [BR:sall04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAZ_40295
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sall00537]
 Enzymes
  SAZ_40295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
9098024..9099382
Genome map
AA seq 452 aa AA seqDB search
MHRPSRRHVVTATALVAATAAAVAVTTAAGASDTKQQAQHAIKGGKAKNVILLIGDGMGD
SEITLARDYVAGANGRLNMDGFPLTGAYTTYAVHADGTPDYVTDSAASGSGWATGRKTVN
GRISKTPDTDKAIPTILELAQKNGYATGSVTTAELTDATPAVLASHATDRSCQGPGDMAK
CPTDTLAKGGPGSIAEQSVNHKVDVLLGGGKQRFDQKVTDGTYKGLTVTEQARKLGYQVV
TDNAGLKDVKAGKPVLGLFAPGNVPTEWTGKPAARGGTDPQRCVTSNANRPAATPTLADS
ATKAIELLEAKQKHAKQGFFLQIEGASIDKQDHAADPCGQIGETAAFDRAVKVARDYAAK
HPDTLVVTTADHGHTSQIVPLEATPPGLSSTLVTNEGQQLKVNYSTNTPGQSQEHTGTQV
RIAAQGPQAYRVLGVTNQTDLFTTIRSALGLK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcacagaccctcccgccggcacgtcgtgaccgccaccgccctggttgccgccaccgcg
gccgccgtggccgtgaccaccgcggccggcgcctccgacaccaagcagcaggcccagcac
gccatcaagggcggcaaggcgaagaacgtcatcctgctgatcggtgacggcatgggggac
tccgagatcaccctggcccgcgactacgtggccggcgccaacggccgcctgaacatggac
gggttcccgctcaccggtgcctacaccacgtacgcggtccacgccgacggcaccccggac
tacgtgaccgactccgctgcgagcggctccggttgggcgacgggccgcaagaccgtcaac
ggtcggatctccaagaccccggacaccgacaaggccatccccaccatcctcgaactggca
cagaagaacggctacgccaccggcagcgtcaccaccgccgaactcaccgacgccaccccg
gcggtgctcgcctcgcacgccaccgaccgctcctgccaggggccgggcgacatggccaag
tgccccaccgacaccctcgccaagggtggcccgggctcgatcgccgagcagtccgtcaac
cacaaggtcgacgtcctcctcggcggcggcaagcagcgcttcgaccagaaggtcaccgac
ggcacctacaagggcctgaccgtcaccgagcaggcccggaagctgggctaccaggtcgtc
accgacaacgccggcctcaaggacgtcaaggcgggcaagccggtcctcggcctgttcgcg
cccggcaacgtgccgaccgagtggaccggcaagccggcggcgcgcggcggcaccgacccg
cagcggtgcgtgaccagcaatgccaaccgcccggcggccaccccgaccctggcggactcg
gccaccaaggcgatcgagctcctggaggccaagcagaagcacgccaagcagggcttcttc
ctccagatcgagggcgcgtcgatcgacaagcaggaccacgccgccgacccctgcggccag
atcggcgagacggccgccttcgaccgtgccgtgaaggtggcccgcgactacgcggccaag
caccccgacacgctcgtggtcaccaccgccgaccacggccacaccagccagatcgtgccg
ctggaggccacccctcccggcctttcctcgaccctcgtcaccaacgagggccagcagctg
aaggtcaactactcgaccaacaccccgggtcagtcgcaggagcacaccggcacccaggtg
cggatcgccgcccagggcccgcaggcgtaccgggtcctcggcgtcacgaaccagacggac
ctgttcaccaccatccggtcggcgctcggcctgaagtga

DBGET integrated database retrieval system