KEGG   Streptomyces albus DSM 41398: SLNWT_0412Help
Entry
SLNWT_0412        CDS       T03823                                 

Definition
(GenBank) DNA ligase
Organism
sals  Streptomyces albus DSM 41398
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
556568..557608
Genome map
AA seq 346 aa AA seqDB search
MKPMLAKSVASIPPDMLYEAKWDGFRAIVFRDGAEVELGSRTGKPLTRYFPELAAALAER
LPERCVLDGEIVIAHDGHLDFDALTERIHPADSRVRLLAERTPASFVAFDLLALGSASLL
DTPQQERRERLESVLAGVRAPVHLAPATTERAVAERWFQEYEGAGLDGVVAKPLGLGYRQ
NERVMFKVKHERTADVVVAGYRHHKSGPVVGSLLLGLYDAAGVLQHVGVAAAFAMKRRAE
LVEELAPLRMESAEGHPWAAWTEESAHESARLPGAPSRWTGKKDLSWIPLRPERVCEVAY
EHMENGARFRHTARFRRWRPDRTPESCTYAQLEEPVRYDLDEILGG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgaagccgatgctcgccaagtcggtggcgagcatcccgccggacatgctctacgaggcg
aagtgggacggcttccgcgcgatcgtcttccgggacggcgccgaggtcgagctgggcagc
cgtaccggcaagccgctgacccgctacttcccggagctggccgcggcgctcgccgagcgg
ctgcccgagcgctgcgtcctggacggcgagatcgtgatcgcccacgacgggcatctggac
ttcgacgcgctcaccgagcgcatccacccggccgattcccgggtgcggctgctcgccgag
cgcacccccgcctccttcgtcgccttcgacctgctcgccctcggctccgcctcgctgctc
gacaccccgcagcaggagcggcgggagcgcctggagagcgtgctcgcgggcgtccgggcg
ccggtgcacctggcgcccgcgaccaccgagcgcgcggtggccgagcgctggttccaggag
tacgagggcgcgggcctggacggggtggtcgccaagccgctcgggctcggctaccggcag
aacgagcgcgtgatgttcaaggtcaagcacgagcgcaccgccgatgtcgtggtcgccggc
taccgccaccacaagagcgggcccgtggtcggctcgctgctgctcggcctgtacgacgcg
gccggggtgctccagcacgtcggggtcgccgccgccttcgccatgaagcgccgggccgaa
ctcgtcgaggagctggcgccgctgcggatggagagcgccgaggggcacccctgggccgcc
tggaccgaggagtccgcgcacgagagcgcccggctgccgggcgccccgagccgctggacc
ggcaagaaggacctgtcctggattccgctgcgccccgagcgggtctgcgaggtggcctac
gagcacatggagaacggcgcccgcttccggcacaccgcccgcttccgccgctggcgcccc
gaccgcaccccggagagctgcacctacgcccagctggaggagccggtccgctacgacctg
gacgagatcctcggcggctga

DBGET integrated database retrieval system