KEGG   Salegentibacter sp. T436: AO058_10120Help
Entry
AO058_10120       CDS       T04614                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
salt  Salegentibacter sp. T436
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AO058_10120
Enzymes [BR:salt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AO058_10120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2311547..2313001)
Genome map
AA seq 484 aa AA seqDB search
MKKTKFLFPFLFSLLLVVSGCSKDDDEVVDETDDITGGKEPEETPNDPEALDLSQYSSGQ
KVMMQTFYWDVEPRFEWWNNLSDKVEGWADTGIDRIWLPVATKGQSGGYSMGYDPSDYFD
FGEYDQHGTVPTRFGTREELENLISKSHELGLEVIADIVLNHNSGGGLEYNPYREKDTYT
LFNEENGNASGMFNRNYEHFHPNDVSQSDEGDLFFSEQDVDHDVPYVQDWFWKNENSVAK
YYKNEMGFDGWRFDYVKGFGTWVIEDWMNEVGGFAVGENFDGNADVLVDWVDATGVSAFD
FAAFYKMEEAFDRFDDLNYLDGNTLRKVNPDKAVTFVANHDTEKDENEDNRIATENKMKA
YAYILTHDGYPTIFYSDYENEAFNEEIKQLIEIHNSLALGDVEVLHVDNNEYVMKREGNA
ENPGLILYISTGNSTKRRNVQTNWNNVTLIDYSGNTTYTPTSDENGMAIIEAPANGYSIY
SITK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaactaaatttttattcccttttcttttcagcttgcttttagtggtatctggc
tgttctaaagatgacgatgaagttgttgatgaaacagatgatattaccggtggcaaagaa
ccggaagaaacccctaatgatcctgaagccttagacctttcccaatattccagcgggcaa
aaagtaatgatgcaaactttttactgggatgtagaaccacgctttgaatggtggaataac
ctttcagataaagttgaaggctgggcagataccgggatagatagaatatggcttcccgta
gctaccaaaggtcagtctggcggttactctatgggctatgacccttcagattatttcgat
tttggagaatacgatcaacacgggactgttcctacacgttttgggactcgcgaagagctg
gaaaatcttatctctaaatctcatgagctgggcttagaggtgattgcagatatcgtttta
aaccataattcgggcggcggcctggaatacaatccatatcgcgaaaaggatacctatacc
ctattcaacgaagaaaatggaaacgcttcagggatgttcaatagaaactacgaacatttt
catccaaacgatgtaagccaaagtgatgagggagatcttttcttttctgaacaggatgta
gatcacgatgttccttatgtacaggactggttttggaagaatgaaaattctgtcgcaaaa
tattacaaaaatgaaatgggttttgacggctggcgatttgattacgtaaaaggttttgga
acctgggtgattgaagattggatgaacgaagttggcggatttgctgttggagagaatttt
gacggaaatgcagatgttctggtagactgggttgacgccactggagtttcagctttcgat
tttgctgccttctataaaatggaagaagcttttgatcgttttgacgacctaaattattta
gacggaaatacacttcgtaaggttaatcctgacaaagctgtgacttttgtagcgaatcat
gacaccgaaaaagacgaaaatgaagacaatcgcatcgctacagagaataaaatgaaagct
tatgcctatattttaacacacgacggatatcctacaattttctactcagattacgaaaat
gaagctttcaacgaagaaattaagcagttaatcgagattcataatagtctggcacttggt
gatgtagaagtacttcatgtagataataacgaatatgtaatgaaaagggaagggaatgct
gaaaaccccggattaattctatatattagcaccggaaattctacaaaacgtagaaacgtt
caaactaattggaataacgttaccttaattgattatagtggtaacacaacatacacccct
acctccgatgaaaacggaatggcaataattgaagctccggcgaatggatattcaatatac
tccatcacgaaatag

DBGET integrated database retrieval system