KEGG   Streptomyces albulus NK660: DC74_4041Help
Entry
DC74_4041         CDS       T03082                                 

Definition
(GenBank) hydrolase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
salu  Streptomyces albulus NK660
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salu00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    DC74_4041
Enzymes [BR:salu01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     DC74_4041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4594170..4595495)
Genome map
AA seq 441 aa AA seqDB search
MSESPETPTSPGPAAAVARTLAARAAELDAGGPLATTRDRFVLDDATVYLDGNSLGALPR
SVPGRIAEVINHEWGELRIRSWTEAGWWTAPERIGEKIAPLIGAAPGQVVVGDSTSVNVF
KAVTGGIRMAGKGCTEILVDATTFPTDGYVARSAARMAGLAVRPVEPARIADEVTERTAL
ALVNHVDYRTGELNDMAAITSALHSAGALAVWDLCHSAGALPVALDACGVDLAVGCTYKY
LNGGPGSPAYLYLRTGLQERFESPLPGWNSHADPFGMDPGYTPADGILRGRVGTPDILSL
LALEAALEAWEGVAIEDVRAKSLALSDFFLECVAAYAPAGRVRSVTPAEHRRRGSQVSLA
CSPDPSASAEEGGTPVAGRVMAELIRRGVVGDFRHPDVLRFGFTPLYTTFADAERAAWVL
GEVLRDPAGAGSAPAVGGAAG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagagccccgagaccccgacgagccccggtcccgccgctgccgtggcccgcacg
ctggcggcccgcgccgcggagttggacgccggcgggcccctggccaccacccgcgaccgg
ttcgtcctcgacgacgccaccgtctacctcgacggcaattcgctgggcgcgctgccccgg
tcggtgcccgggcggatcgccgaggtgatcaaccacgagtggggcgagctgcgcatccgg
tcctggaccgaagccggttggtggaccgcgcccgagcggatcggcgagaagatcgccccg
ctcatcggggcggcccccggccaggtggtggtcggcgactccaccagcgtcaacgtcttc
aaggcggtgaccggcggcatccggatggccgggaagggctgtacggagatcctggtcgac
gccacgaccttccccaccgacggctacgtcgcccggtccgcggcccggatggcgggtctg
gcggtccggccggtcgagcccgcgcggatcgccgacgaggtcaccgagcggaccgcgttg
gcgctggtcaaccacgtcgactaccgcaccggcgagctcaacgacatggccgcgatcacc
tccgcgctgcacagcgcgggcgcgctggcggtctgggacctgtgccacagcgccggggcg
ctgccggtcgcgctggacgcctgcggggtggacctcgcggtgggctgcacctacaagtac
ctcaacggcggcccgggttcgcccgcgtacctctacctccgcacgggcctccaggagcgg
ttcgagtcgccgctgcccggctggaactcgcacgccgacccgttcggcatggatcccggc
tacacccccgccgacggcatcctgcgcggccgcgtgggcacccccgacatcctctcgctg
ctggcgctggaggcggcgctggaggcgtgggagggcgtcgccatcgaggacgtgcgggcc
aagagcctggcgctgagcgacttcttcctggagtgcgtcgcggcgtacgcgccggccggg
cgggtccgttcggtcaccccggccgagcaccggcggcgcggcagccaggtgtcgttggcg
tgctcccccgacccgtccgcgtcggccgaggagggcgggacgcccgtggccggccgggtc
atggcggagctgatccggcgcggtgtggtcggcgacttccgccacccggacgtgctgcgc
ttcggcttcacgccgctctacaccaccttcgcggacgcggagcgggcggcgtgggtgctc
ggcgaggtgctgcgcgacccggccggggcgggatcggcgccggcggtcggcggtgccgcc
gggtga

DBGET integrated database retrieval system