KEGG   Streptomyces albulus NK660: DC74_469Help
Entry
DC74_469          CDS       T03082                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
salu  Streptomyces albulus NK660
Pathway
salu00473  D-Alanine metabolism
salu00550  Peptidoglycan biosynthesis
salu01100  Metabolic pathways
salu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:salu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    DC74_469
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DC74_469
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    DC74_469
Enzymes [BR:salu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DC74_469
Peptidoglycan biosynthesis and degradation proteins [BR:salu01011]
 Precursor biosynthesis
  Amino acid ligase
   DC74_469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATPgrasp_Ter ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AIA00995
UniProt: A0A059VUC5
LinkDB All DBs
Position
complement(502492..503550)
Genome map
AA seq 352 aa AA seqDB search
MVSQSRLVVGLTYNLRGESVEHFGAGPPREGYDAEFDEWETVQTVAGVLEGLGYRCVLIG
ALPALMERLLRGERWDVVFNLAEGHHGYGREAQVPALLEEWRIPFTFSDSLCLSLCLHKP
TTQLLLRQAGVTTAPFAVVREPHDIDGIDLPYPLFAKPVAEGTSKGIGADSRVDDARELR
STCTRLLQRHGQPVMVEPYLPGPEYTVGILGAGADARAVGVSQTLHDRRTTPFLTDLRKR
DASGQPVPVRALQDTGAAQRLAGLAVRAWRTLGCRDAGRVDLRCDAAGEPHVLDVNPLPG
LSPTYSPLPLQWAGTGRPYRQLIARIMTAAEHRLPCASSAVPASTAARRVGC
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgcagtctcggctggtcgtggggctcacctacaacctgcgcggtgagtccgtc
gagcacttcggcgccggcccgcccagggaggggtacgacgcggagttcgacgagtgggag
acggtgcagaccgtcgccggcgtcctcgaagggctcggctaccggtgcgtgctgatcggt
gcgctgccggcgttgatggagcgcctgctgcgcggcgaacgctgggacgtcgtcttcaac
ctcgccgaggggcaccacggctacgggcgcgaagcccaggttcccgcgctgttggaggag
tggcggatccccttcacgttctcggactccctgtgcctgtcgctgtgcctgcacaagccc
accacccagctgctgctgcggcaggcgggggtgacgacggcaccgttcgccgtcgtccgg
gagccccacgacatcgacgggatcgacctgccgtacccgttgttcgccaagccggtcgcc
gagggcaccagcaagggcatcggcgcggactcccgcgtggacgacgcgcgggagctgcgg
tcgacctgcacgcggctgctgcaacggcacggccagccggtgatggtcgagccgtacctc
cccggcccggagtacaccgtcggcatcctcggcgccggtgcggacgcccgggccgtcggc
gtgtcgcaaaccctccacgaccggcggacgacgcccttcctcaccgatctgcgcaagcgc
gacgcatcgggtcagccggtccccgtgcgggccctccaggacaccggcgccgcgcagcgc
ctcgccggcctcgccgtccgggcctggcgcacgctcggttgccgggacgccggccgggtc
gacctgcggtgcgacgcagccggtgagccccacgtcctggacgtcaacccgctgcccggc
ctcagccccacctactccccgttgcccctccagtgggccggcaccggccggccgtaccgc
cagctcatcgcgcgcatcatgaccgccgccgagcaccgcctgccgtgcgcgtcgtccgcc
gtgccggcgtcaacggccgcacgccgggtggggtgttga

DBGET integrated database retrieval system