KEGG   Streptomyces ambofaciens: SAM23877_4639Help
Entry
SAM23877_4639     CDS       T04055                                 

Gene name
mdh
Definition
(GenBank) Malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
samb  Streptomyces ambofaciens
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:samb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAM23877_4639 (mdh)
   00620 Pyruvate metabolism
    SAM23877_4639 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    SAM23877_4639 (mdh)
  Energy metabolism
   00680 Methane metabolism
    SAM23877_4639 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAM23877_4639 (mdh)
Enzymes [BR:samb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SAM23877_4639 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4915416..4916405
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVKLRLLEITPALNAAAGTAMELDD
CAFPLLQGIEITDDPNVAFDGANVALLVGARPRSKGMERGDLLEANGGIFKPQGKAINDH
AADDIKVLVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRALTQLAKKTGSSVTDIK
RLTIWGNHSATQYPDIFNATIAGKNAAEVVDDEKWLAEDFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVHTWVNGTADGDWASMGIPSDGSYGVPEGLISSFPVTCKDGKYEIVQGLE
INDFSRARIDASVKELSEERDAVRGLGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtgaacgtcaccgtcaccggcgcggccggccagatcggttacgcc
ctgctcttccgcatcgcctccggccagctgctcggcgcggacgtgccggtcaagctccgc
ctcctggagatcaccccggcgctcaacgccgccgcgggcaccgcgatggagctggacgac
tgcgcgttcccgctgctccagggcatcgagatcaccgacgacccgaacgtcgccttcgac
ggtgccaacgtcgccctcctcgtgggcgcccgcccgcgcagcaagggcatggagcgcggt
gacctcctggaggccaacggcggcatcttcaagccgcagggcaaggccatcaacgaccac
gccgcggacgacatcaaggtgctcgtggtcggcaacccggccaacaccaacgccctgatc
gcccaggccgccgccccggacgtaccggccgagcgcttcaccgcgatgacgcgcctggac
cacaaccgcgcgctgacccagctcgcgaagaagacgggctcgtcggtcaccgacatcaag
cgcctgaccatctggggcaaccactccgccacccagtacccggacatcttcaacgccacc
atcgccggcaagaacgccgccgaggtcgtcgacgacgagaagtggctggccgaggacttc
atcccgaccgtcgccaagcgcggcgccgccatcatcgaggcccgcggcgcctcgtcggcc
gcctccgccgccaacgccgccatcgaccacgtccacacctgggtcaacggcaccgccgac
ggcgactgggcctccatgggcatcccgtcggacggctcctacggcgtcccggagggcctc
atctcctccttcccggtcacctgcaaggacggcaagtacgagatcgtccagggcctggag
atcaacgacttctcccgcgcccgcatcgacgcctccgtcaaggagctgtcggaggagcgc
gacgcggtccgcggtctcggcctcatctga

DBGET integrated database retrieval system