KEGG   Streptomyces ambofaciens: SAM23877_6028Help
Entry
SAM23877_6028     CDS       T04055                                 

Definition
(GenBank) Aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
samb  Streptomyces ambofaciens
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:samb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SAM23877_6028
   00650 Butanoate metabolism
    SAM23877_6028
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAM23877_6028
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAM23877_6028
Enzymes [BR:samb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SAM23877_6028
Amino acid related enzymes [BR:samb01007]
 Aminotransferase (transaminase)
  Class III
   SAM23877_6028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6525170..6526453
Genome map
AA seq 427 aa AA seqDB search
MTKDLFGRHRAVLPDWLALYYEDPLEITHGEGRHVWDAAGNKYLDFFGGILTTMTAHALP
EVTKAVSEQAGRIIHSSTLYLNRPMVELAERVAHVSGIPDARVFFTTSGTEANDTALLLA
TAHRRSNTILAMRNSYHGRSFSAVGITGNRGWSPTSLTPLQTLYVHGGVRTRGPYAHLDD
RAFIDACVADLEDLLGHTRAPAALIAEPVQGVGGFTSPPDGLYAAFREVLHERGILWIAD
EVQTGWGRTGEHFWGWQAHGRSGPPDIVTFAKGIGNGMSIGGVIARAEIMNCLDANSIST
FGGTQVTMAAGLANLSYLLEHDLQGNARRVGGLLIERLRGVAAQVPHVREVRGRGLMIGV
ELTRPGTDEAAPEAASTVLEEARAGGLLIGKGGGHSTSVLRIAPPMSLTVAEAEEGAAIL
DRALRSI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaggacctcttcggccgtcaccgggccgtcctgcccgactggctcgccctgtac
tacgaggacccgctggagatcacccacggcgagggccggcacgtctgggacgccgccggc
aacaagtacctcgacttcttcggcggcatcctcaccacgatgaccgcgcacgccctgccc
gaggtgaccaaggcggtgagcgagcaggcgggtcggatcatccactcctcgaccctctac
ctcaaccggcccatggtcgaactcgccgagcgcgtcgcccacgtctccggcatccccgac
gcccgtgtcttcttcaccacctccggcaccgaggccaacgacaccgccctgctgctcgcc
accgcccaccggcgcagcaacaccatcctggcgatgcgcaacagctaccacggccgttcc
ttcagcgccgtcggcatcaccggcaaccgcggctggtccccgacctcgctcaccccgctc
cagacgctgtacgtccacggcggcgtccgcacccgcggcccctacgcgcacctggacgac
cgcgcgttcatcgacgcctgcgtggccgacctggaagacctgctggggcacacccgcgcc
cccgccgcgctgatcgccgaacccgtccagggcgtcggcggcttcacctccccgcccgac
gggctctacgcggccttccgcgaggtgctgcacgagcggggcatcctgtggatcgccgac
gaggtgcagaccgggtggggccgcaccggcgagcacttctggggctggcaggcccacggg
cgaagcggcccgcccgacatcgtgaccttcgccaagggcatcggcaacgggatgtcgatc
ggcggcgtcatcgcccgcgccgagatcatgaactgcctcgacgccaacagcatctccacc
ttcggcggtacccaggtcaccatggcggccggcctcgccaacctctcctacctgctggaa
cacgacctccagggcaacgcccggcgcgtcggcggactgctcatcgagcggctgcgcggc
gtcgccgcccaggtgccgcacgtgcgggaggtgcgcgggcgggggctgatgatcggcgtc
gagctgacccggcccggcaccgacgaggccgcccccgaagcggcgtccaccgtgctggag
gaggcccgcgcgggcgggctgctcatcggcaagggcggcggccacagcaccagcgtcctg
cgcatcgcaccgccgatgtccctcaccgtcgcggaggccgaggagggcgccgcgatcctg
gaccgcgccctgcggagcatctga

DBGET integrated database retrieval system