KEGG   Staphylococcus aureus MS4: NI36_10415Help
Entry
NI36_10415        CDS       T04800                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sams  Staphylococcus aureus MS4
Pathway
sams00010  Glycolysis / Gluconeogenesis
sams00053  Ascorbate and aldarate metabolism
sams00071  Fatty acid degradation
sams00280  Valine, leucine and isoleucine degradation
sams00310  Lysine degradation
sams00330  Arginine and proline metabolism
sams00340  Histidine metabolism
sams00380  Tryptophan metabolism
sams00410  beta-Alanine metabolism
sams00561  Glycerolipid metabolism
sams00620  Pyruvate metabolism
sams00625  Chloroalkane and chloroalkene degradation
sams01100  Metabolic pathways
sams01110  Biosynthesis of secondary metabolites
sams01120  Microbial metabolism in diverse environments
sams01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sams00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NI36_10415
   00053 Ascorbate and aldarate metabolism
    NI36_10415
   00620 Pyruvate metabolism
    NI36_10415
  Lipid metabolism
   00071 Fatty acid degradation
    NI36_10415
   00561 Glycerolipid metabolism
    NI36_10415
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NI36_10415
   00310 Lysine degradation
    NI36_10415
   00330 Arginine and proline metabolism
    NI36_10415
   00340 Histidine metabolism
    NI36_10415
   00380 Tryptophan metabolism
    NI36_10415
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NI36_10415
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NI36_10415
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NI36_10415
Enzymes [BR:sams01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     NI36_10415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALR00229
UniProt: A0A181E8H8
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(2058675..2060102)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVKSNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADNVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtaaaaagtaatagtaatgaa
acgatagaagttataaatccagcaactgaagaagtaattgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagataatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcattattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgagttaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggcttaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcggcagca
tttgcggctggtagtccagttgtacttaaaccatcagaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggagttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
tttacaggatcaggccctactggttctaaaattatggaaaaagctgctaaagactttaaa
aaggtatcattagagcttggtggcaaatcaccatacatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcggttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gacttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggctattttaaataa

DBGET integrated database retrieval system