KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs1919Help
Entry
gbs1919           CDS       T00104                                 

Definition
(GenBank) Unknown
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
san00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    gbs1919
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    gbs1919
Enzymes [BR:san01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     gbs1919
Bacterial toxins [BR:san02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   gbs1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR NCBP3
Motif
Other DBs
NCBI-ProteinID: CAD47578
UniProt: Q8E343
LinkDB All DBs
Position
complement(1990273..1992723)
Genome map
AA seq 816 aa AA seqDB search
MTLTFGKPSITIRRLGVITSTYMMLGFILLCGFLHPSTIYSEEIKSDINSFISIDDEKTT
VPIFDSTLDKLTNSIEERQLELDSDTSDSLIVDDQKDKDMVIVLGDSDSQEKLSPPLKSE
IATEENRKQANLAELNATQPNNRTTYIIPESSHSIAEQQRFLIESKGYSVALLNSDEFRK
TAREDRGFERDKLRSLDIIPKGDLSTSNVIGNTDIASQISLGFKKNAIQEHHLTKTFSQK
DGKLSSVIEGMLAIGKEKVEKEIKYSGNLWQKLKAKAHCLVCCVDNLNFEDIKSYFQYYC
HLNHQLKLPKGAILSAKTEVYRGGDFGRKNKDNVFGYRIPSLLKTEKGTLLVGADERIEQ
ACDWGNIGMVIRRSEDDGVTWGKRETIVNLRNNPRVPLVTSGDYSGSPINMDMALVQDTS
SKTKRIFSIYDMFPEGRGVISIANTPEKEYTQIGGQSYLNLYNNGKKSKVFTIRDKGIVY
NFKGKKTDYHVITETTKSDHSNLGDIYKGKQLLGNIYFTKHKTSPFRLAKSSYVWMSYSD
DDGRTWSSPRDITASLRQKGMKFLGIGPGKGIVLKWGPHAGRIIIPAYSTNWKSHLRGSQ
SSRLIYSDDHGKTWHTGKAVNDNRILSNGEKIHSLTMDNKKEQNTESVPVQLKNGDIKLF
MRNLTGNLEVATSKDGGETWQNHVKRYKEVHDAYVQLSAIRFEHDKKEYILLVNANGPGK
KRQDGYARLAQVNRNGSFKWLYHHHIQDGSFAYNSVQQLNNDKFGVLYEHREKHQNSFTL
NYKVFNWSFLSQNTEKQGTLWEKMAANWHVLFKFYL
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgacattaacctttgggaaaccttctataacgatacgccgtctaggagtgataactagt
acatatatgatgctaggttttatcttattatgtggatttttgcatcctagtacaatttat
agtgaggaaataaaatctgatataaactcttttatatcaatagatgatgaaaaaactact
gttcccatatttgactctactttagataagcttactaattcaatagaggagaggcagtta
gaattagattctgatacatcggacagtttaatagtagatgatcaaaaagataaagatatg
gtaatagtcttaggtgattctgacagtcaagaaaaattgtcacctcctctaaaatcggaa
atagcgacagaagaaaatcgtaaacaggcaaatttagcagaactaaatgcaactcaacct
aataatagaactacctatattatacccgaaagcagtcattccattgcagaacaacagaga
ttcctgatagaatcaaagggttattcggttgcattacttaatagcgatgaatttagaaag
acagcgagagaggatagaggttttgaaagggataagttgaggtctttggatatcattcct
aagggagatttatcgacaagtaatgtcataggtaatacggacattgctagtcagatatcg
ttgggctttaaaaagaatgcgatacaggaacaccatcttactaaaacattctctcaaaag
gatggaaagttatcgtctgttatagaggggatgcttgctattggcaaagagaaagtagag
aaggaaataaaatatagtggtaatttatggcaaaaattaaaagctaaggcacactgcctt
gtttgctgtgttgataatttgaattttgaagatataaaatcttattttcaatattattgt
catctaaaccatcagctcaaattacctaaaggtgctatactttctgctaaaacagaagta
tataggggaggagattttgggagaaaaaataaagataatgtgtttggttaccgtatcccc
tcattattaaaaacggaaaaaggaactttacttgtgggagctgatgaaagaattgagcaa
gcttgtgattggggaaacataggaatggttattcgccgtagtgaggatgatggtgtcact
tggggaaaaagagaaactattgtcaatctccgtaataaccctagagttccgctagttact
agtggtgactatagtggctcacctattaatatggatatggcattagttcaagatactagc
tctaagacgaaacgtattttttcaatatatgatatgtttccagaaggaagaggcgttatt
agtattgctaacacacctgaaaaagaatatacccaaatcggaggacagtcttatcttaat
ttatataataatggaaagaaatcgaaggtttttactatccgtgacaaaggtattgtatat
aattttaaagggaaaaagactgattatcatgttataacagaaactactaaaagtgaccat
tcaaatctaggggatatttataagggaaaacagctacttggaaatatatattttacaaaa
cataaaacgtcaccatttcgtttagcaaaatcaagctatgtgtggatgtcatatagcgat
gatgatggtaggacatggtcatcacctagagatataacagcaagtcttcgtcagaaaggc
atgaaatttttaggaataggacctggaaaaggtatagttttaaaatgggggccacacgct
ggtcgtattattattcctgcctattctacgaattggaaatctcatctaagaggttcacaa
tcttcacgcctaatttattcagacgaccatggaaaaacgtggcatactggaaaagcagtc
aatgataaccgtatactttctaatggtgaaaaaattcactccttaacaatggataataaa
aaagaacaaaatacagaatccgtacccgttcaattgaaaaatggggacattaagttattt
atgaggaatctaactggtaacctagaagtagccacaagtaaagacggcggggagacttgg
caaaaccatgttaaacgatataaggaagttcatgatgcttacgtccaattatcagctatt
cgctttgagcatgacaaaaaagagtatattttattagtgaatgctaatgggccaggtaag
aagcgtcaagatggatatgcacgtctagcgcaagttaatcgaaatggtagttttaagtgg
ttatatcaccatcacattcaagatggttcgtttgcttacaactctgttcaacaacttaat
aatgataaatttggtgtcctttatgaacatagagaaaaacatcaaaatagttttacttta
aattacaaagtttttaattggagttttcttagtcaaaatacagagaagcaaggcacttta
tgggagaaaatggcagcaaattggcatgttttgtttaaattttatttatga

DBGET integrated database retrieval system