KEGG   Streptococcus anginosus C238: SANR_1026Help
Entry
SANR_1026         CDS       T02829                                 

Gene name
acoC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sanc  Streptococcus anginosus C238
Pathway
sanc00010  Glycolysis / Gluconeogenesis
sanc00020  Citrate cycle (TCA cycle)
sanc00620  Pyruvate metabolism
sanc01100  Metabolic pathways
sanc01110  Biosynthesis of secondary metabolites
sanc01120  Microbial metabolism in diverse environments
sanc01130  Biosynthesis of antibiotics
sanc01200  Carbon metabolism
Module
sanc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sanc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SANR_1026 (acoC)
   00020 Citrate cycle (TCA cycle)
    SANR_1026 (acoC)
   00620 Pyruvate metabolism
    SANR_1026 (acoC)
Enzymes [BR:sanc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SANR_1026 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding CAT
Motif
Other DBs
NCBI-ProteinID: AGU83488
LinkDB All DBs
Position
complement(1056125..1057195)
Genome map
AA seq 356 aa AA seqDB search
MNYLRMRENMDDKKLRATPAARKLADDLGINLYDVSGTGAKGRVHKEDIESYRESNIMKI
TPLAKRIAEENNIAWQEIQGTGVHGKIMKKDILALLPENVESDSIKSPAQIEKAEEISDN
ITPYGEIERLPMTPMRKVIAQRMLDSYLTAPTFTLNYDVDMTELLALRKKVLEPIMEATG
KKITVTDLLSMAVVKILMKHPYLNSSLTEDGQTIIMHKYVNLAMAVGMDNGLMTPVVYNA
EKMSLSELVVAFKDVIERTLNGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILG
VSSTVEKPVVVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKELIEDPISMLV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaattatttaagaatgagagagaacatggatgacaaaaaattaagagcgacccctgct
gctagaaaattagcagatgacttgggtatcaatctctatgacgtatctggtactggtgca
aagggacgcgttcacaaagaagatattgaaagttatcgagaatccaatattatgaaaatt
acgccccttgcaaaacgtattgcagaagaaaataacatcgcttggcaggaaatccaaggg
acaggcgtgcacggcaagattatgaaaaaggatattctggctttgctgcctgaaaatgtt
gagtcagacagcatcaagtcacctgctcagattgagaaagcggaagaaatatctgacaac
atcactccttatggagaaattgagcgccttccaatgacgccaatgcgaaaagtcattgcc
caaagaatgcttgattcttacctgacagcgccaactttcactctcaattatgatgtagat
atgacagagctgctggcgctgcgtaaaaaggttttagagccaatcatggaagcgacagga
aagaaaatcacggtcacagacttgctttctatggcagttgttaaaatcttaatgaagcac
ccttatctcaattcgtctctgacagaagatgggcaaaccattatcatgcacaagtatgtc
aatctggctatggctgttgggatggacaatgggcttatgacaccagtggtttacaatgct
gaaaaaatgagtctgtctgagttagtcgttgcctttaaggatgtgattgaacggacttta
aatggaaaattagcaccaagcgaattgcaaaactcaacttttacgattagtaatctagga
atgtttggtgttcaatcgttcggcccaattatcaatcaacccaattcagcgattttgggc
gttagctcaaccgttgaaaaaccagtcgtagtgaacggagagattgttattcgaccaatt
atgagtcttggattaaccattgatcaccgagtcgtggacggtatggcaggtgctaaattc
atgaaagacctaaaagaactgattgaagacccaatttcaatgttggtataa

DBGET integrated database retrieval system