KEGG   Sinocyclocheilus anshuiensis: 107659894Help
Entry
107659894         CDS       T04917                                 

Definition
(RefSeq) DNA ligase 1-like isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh03030  DNA replication
sanh03410  Base excision repair
sanh03420  Nucleotide excision repair
sanh03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sanh00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    107659894
   03410 Base excision repair
    107659894
   03420 Nucleotide excision repair
    107659894
   03430 Mismatch repair
    107659894
Enzymes [BR:sanh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107659894
    6.5.1.6  DNA ligase (ATP or NAD+)
     107659894
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107659894
DNA replication proteins [BR:sanh03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107659894
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107659894
DNA repair and recombination proteins [BR:sanh03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107659894
   NER (nucleotide excision repair)
    Other NER factors
     107659894
   MMR (mismatch exicision repair)
    Other MMR factors
     107659894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 107659894
NCBI-ProteinID: XP_016304483
LinkDB All DBs
Position
Unknown
AA seq 989 aa AA seqDB search
MQRSIASFFQPMKSKEKSDGQVKAKTEPVKSPLKIQNGMQESDSPVKKVHKRSRAIIDSD
DEDQPIVKEQVPKQSEVEPVKPEKKSDVTKAASTPVSPKTPITPTTPVTSSTSVAVVTPA
SSGTPGTPATPTSTSPSGIPKRKTARKQFPKRKLESRSDGEGAKEEGKEVDEGQESKRAR
VEASPGQTDNEMMEVEEKSADGKTAVEEQKEKDEAKTTVVEDNANNKMKEKVKNKVKQEK
KINVENGKKEKKEDNKEKEHSSPERAVKKEKNTEEEGGSAKKKPISSFFAPRKAAVKLEK
EERNEGEKKKDGEISDAAEQKEKKRLNEKGVDSAVQSQYDPSRAHYHPVDHACWRKGQKV
PYLAVARSFEKIEEDSGRLKNIETLSNFLRSVILLSPDDLLCCVYLCLNQLGPAYQGLEL
GIGETVLMKAVAQATGRQLDKIKAEAQEKGDLGLVAESSRSNQRMMFAPANLTAGGVFNK
LKEIANMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLTALSQAV
CLSPPGQEFPPAVLNAGKGMSAENRRVWLEEKALILKQTYCEMPNYDAIIPVLMKEGIDE
LPNHCKLTPGVPLRPMLAHPTKGVGEVMKRFDEAAFTCEYKYDGERAQIHILENGELRIF
SRNQEDNTSKYPDIISRIPQVKKENVRSCVLDSEAVAWDREKKQIQAFQVLTTRKRKDVD
ASEIKVQVCVYAFDLLYLNGASLVREPLSKRRALLRESFEEKEGEFVFARSLDSDNTESI
AEFLEQSVRDSCEGLMVKTLEKHATYEIAKRSHNWLKLKKDYLEGVGDTVDLCVIGAYLG
KGKRAGSYGGFLLACYDEENEEFQSVCKIGTGFKDEDLEQHYNFLKEHILPKPRPYYRVD
QSAEPDVWLEAVQVWEVKCADLSLSPVYKAAMGLVDPEKGISLRFPRYLRIRDDKKPEDA
TTGSQIADLYKKQQQIQNQGEKQDLEDYY
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatcgcgtcattctttcagccaatgaaaagtaaggagaagagtgatgga
caggtcaaagcaaagactgaacctgtaaaaagtcccctcaaaattcagaatggtatgcag
gaaagcgattcaccagtaaagaaggttcataaacgcagtcgagcaatcatagacagcgat
gatgaagatcagccgatagtaaaagagcaggtgccaaaacagagtgaagttgaaccagta
aagccagagaagaaatctgatgttacaaaggctgcttccactccggtttctccaaaaaca
cccataaccccgacgactccggtcacgtcgagtacctctgttgcggtggtaacccctgct
tcctcaggtactccgggaactccagcaactccgacatcaacatcgccgtcaggcattccc
aaacgcaagaccgcccgcaagcagttccccaagaggaagctggaaagcagaagtgatgga
gagggggcaaaagaggaggggaaggaggtcgacgaagggcaggagagtaagagagcacga
gttgaggcctcacctggacagacagacaatgagatgatggaggtggaagagaagagcgca
gatgggaagactgcagtggaggaacagaaagagaaggatgaagcaaaaacaaccgtagtt
gaggacaatgcaaacaataagatgaaagaaaaggttaaaaataaggtaaaacaggagaaa
aagataaatgtagaaaatgggaagaaagaaaaaaaagaagacaacaaagagaaggaacat
agcagtcccgaacgagcggttaaaaaagaaaaaaacacagaggaggaagggggatcggcc
aaaaagaaacccatcagcagcttttttgctcccagaaaggcagctgtcaaactggaaaaa
gaggagcgaaatgagggagaaaaaaagaaggatggggagatctctgatgctgctgaacag
aaagagaagaaaaggttgaatgaaaagggggtggattctgcagtccagagccagtatgat
ccctccagagcacattaccatcccgttgaccacgcctgctggaggaagggccaaaaagtg
ccatatttggctgtcgctcgcagttttgagaagattgaagaggattcgggcaggctgaag
aacattgaaacgctttccaactttctgcgatctgtaattctgctttctccagatgacctg
ttatgctgtgtgtacctgtgtctgaatcagctcggccctgcatatcagggtctggagctg
ggcattggggagaccgtcctgatgaaagctgtcgctcaagcaactgggcgacaactggac
aaaatcaaggcggaggctcaggagaaaggtgacctgggattggttgctgaaagttctcgc
agcaaccagagaatgatgtttgcaccggccaatctgacagcagggggcgttttcaacaaa
ctgaaagagattgctaacatgagtggaaattctgcaatgaataagaagattgacattatt
aaaggcttgtttgtggcgtgtcggttttctgaggctcgatacattgtgcggtcactggct
gggaagctgcggatcggattggctgagcagagcgttctcacggctctcagtcaggctgtg
tgtctgtcgcccccgggccaagagttcccaccagctgtgctgaatgcagggaaaggaatg
agtgcagaaaaccggagagtgtggctggaggagaaagcactgatcctaaaacagacatac
tgtgagatgccaaattatgatgcaatcattcctgttttgatgaaggagggcatagatgaa
ctgcccaatcactgcaagctcaccccaggtgtgcccctgcgaccaatgttggctcacccg
actaaaggggttggtgaggtaatgaaacgtttcgatgaggcagctttcacctgcgagtat
aaatatgatggagagagagcccagatccatattcttgagaatggagagttgcgcattttt
agccgaaaccaagaagacaacacaagcaaataccctgatattatttctcgaatcccacag
gtgaagaaagagaacgtgcggtcctgtgttctggattcagaggcggtggcctgggacaga
gaaaagaaacagatccaggcatttcaggtcctcaccacaaggaagagaaaggatgtggat
gcatctgagatcaaggttcaggtgtgtgtgtacgcctttgatctgctgtacctcaacgga
gcgtctctggtgcgagagcctctaagcaaacgcagggctctgttacgagagagttttgag
gagaaagaaggagagtttgtttttgctcgatctctggactctgacaacacagagagcatt
gctgagttcctggagcagtctgtacgagattcttgtgagggcctaatggtgaagacactg
gaaaaacatgcaacttatgagattgccaaacgctcccacaactggctcaagctgaagaag
gactatctggagggtgttggagacacagtggatctgtgtgtgattggtgcttatctaggg
aaggggaagagagcaggcagctatggaggatttctactggcctgctacgatgaggagaac
gaggagttccagtctgtctgcaagattggaacaggcttcaaagatgaagatctagagcaa
cattacaatttcttaaaggagcacattttacctaaaccacgtccatattaccgtgtggac
caatcagcagagccagatgtctggctggaggcggtgcaagtgtgggaggtgaaatgcgct
gacctttcactgtctccggtctacaaggcagcgatgggattggtggacccagagaaaggc
atttcacttcgtttcccacggtacctcaggattagagatgacaaaaagccagaggatgcc
accacagggtcacagattgcagatctttacaagaaacagcagcagattcaaaatcagggt
gaaaaacaagatctggaggactactattga

DBGET integrated database retrieval system