KEGG   Sinocyclocheilus anshuiensis: 107664131Help
Entry
107664131         CDS       T04917                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
Enzymes [BR:sanh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107664131
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 711 aa AA seqDB search
MSSSNTNTARGPSASAPAAATLAASDTLLTVHSVDLLKSKDGPNRREHRTDAYFSDKLII
RRGQTFQMWIEFSRPFNPKSDNLQLQLKLEPIFSSSTGIHISVPLVDVLEDGRWEMKIVE
QKDKRVRLAVNTLPTASIGCYKVTVESFSPKGKLLFPCTPNDVYLLFNPWCEDDAVYLDN
EAERKEYILNSMGRIYYGTEKQIGTRTWNFAQFEQDILEACLFILERGQVAMTEWRDPVI
VSRMVSALVNSNDDYGVLMGNWKDSYEGGTSPTAWSGSGDILRQYYKSSGKPVKFAQCWV
YAGVTNSVLRCLGIPTRCVTNFSSAHDTDLSLTTDIYIDEKLEVIKDKTSDSLWNFHVWN
ESWMTRPDLPAGYGGWQVVDATPQEPSQGSYRCGPTSVSAVRKGQVELKFDTPFVFAEVN
SDRIYWQKKPDGSFSQVNVEKNSIGQSISTKAVGSDARVDITHLYKYPEGSEEERIAVER
ASRFGSKPTLYPSPTGNDVSVEIVMDGAGPRIGGDAKLSIVLKNKSSSQRTASLLYEVMV
MYYTGVLKTTVKKDQIPLTLKPQETKTIPWTLQYKEYMSHLVDQGALMLAVTGRVNETRQ
ILATQFNFRLRTPDLIITPQGDAVVGKELTVKITFQNPLSQVLRNVLFRIEGLGMQSIRK
IAYGDVDKLATVTLTEKFVPTVAGSQKLLASMDCRLLTQVHGVADLVVKPK
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtctagctctaacaccaacactgctagaggtcccagtgccagcgctcctgcagctgcg
accctggcggcttcagacacgcttctgacggttcactccgtcgacctcctgaaatccaag
gatgggccgaaccgacgcgagcatcgcacagacgcttacttcagcgacaagctgatcatc
cgcagaggacagaccttccagatgtggatcgagttctccagacccttcaaccccaaatct
gacaatctgcagctgcagctgaagttagaacccatcttcagcagtagcactgggattcac
atctctgtcccgttagtggacgtcctggaagacggccgctgggagatgaagatcgtggag
cagaaagacaaacgtgtgcggctggcggtcaacactcttcccaccgcctccatcggctgc
tacaaggtgaccgtcgagtctttctcaccgaagggcaagctgctgttcccctgcaccccc
aacgacgtctacctgctcttcaacccctggtgtgaagatgatgccgtgtatctggataat
gaagcagaaaggaaagagtatatcctgaatagcatgggcagaatttactacggaactgag
aagcaaattggaaccagaacatggaattttgcccagtttgaacaggatatcctagaagca
tgtctgttcattttggagagaggtcaggtcgctatgaccgaatggagagatccagtgatt
gtgtccagaatggtatctgctctggtgaactccaacgatgactacggtgttctgatgggt
aactggaaggacagctatgagggtgggacgtctcccaccgcctggagcggcagcggcgac
atcctgagacagtattacaaaagctcagggaaacctgtcaaattcgcccagtgctgggtc
tatgcgggagtcaccaattccgtgttgagatgtcttggtattcccacccgctgtgtgacc
aacttcagctcggctcacgacacggacctttccttgaccacagacatttatattgacgag
aagctggaagttatcaaagacaagaccagcgattctctctggaacttccacgtgtggaac
gagtcctggatgacccgtccggacctcccggctggttacggcgggtggcaggtggtggac
gcgacccctcaggagcccagccagggttcgtaccgctgcggtcccacttccgtctccgcc
gtccgcaaaggacaagtcgaactgaaattcgacactccatttgtctttgccgaagtgaac
agtgataggatctactggcagaagaaacccgatggaagcttcagtcaggttaatgtggag
aagaactccatcggtcagagcatcagtactaaagctgtgggatctgatgctcgtgtggac
atcacacacctctacaaatacccagaaggttcagaggaggagcgcattgctgtggaaagg
gccagtcgcttcggctccaaaccgactttgtatccgtctcccaccggcaatgacgtgagc
gttgagattgtcatggacggggcagggcctcgtatcggtggagatgccaaactctccatc
gtcctgaagaacaaaagctcaagtcagcgcacggccagtctgctgtatgaggtgatggtc
atgtactacaccggtgtgctgaaaaccactgtgaagaaggatcagattcctctcaccctc
aaaccgcaagagaccaagactattccttggactctgcagtataaggagtacatgagccat
ctggtggaccagggcgctcttatgctagcggtcactggacgggtcaacgagacccgacag
attctggccacacagttcaacttcaggctgcgcacaccagacctcatcatcactcctcaa
ggggatgctgtggtgggtaaagagttgacagtcaagatcacgttccagaacccgctgtca
caagtgttgaggaacgttttgttccgtatagagggattgggaatgcagagcatcaggaag
atcgcgtatggtgatgtggataaacttgcgacggttacactgacagagaagtttgttccc
actgtcgccggctctcagaagctcctggcatcgatggactgccgtctgctcactcaagtg
cacggagtcgctgatcttgtggtcaaaccaaagtag

DBGET integrated database retrieval system