KEGG   Sinocyclocheilus anshuiensis: 107664635Help
Entry
107664635         CDS       T04917                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     107664635
Peptidases [BR:sanh01002]
 Metallo Peptidases
  Family M2
   107664635
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107664635
CD molecules [BR:sanh04090]
 Proteins
  107664635
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1281 aa AA seqDB search
MYRAVVLLTLISTSAALKPEWIPGDYSMTEAGAESFVSDYNSTAEEVFYFSTEASWNYNT
NLTDHNSQLQIAASLEEQAFTEAWGQKAKATFSDSLMDTFTNPDLKKIINNINVLGPANL
PTAEREKYNTILSQMDSIYSTAKVCPSEECWSLEPELTEIMATSRSYKRLLYAWEGWHNA
SGVPLRSLYSEFVELSNKASRMDGVNDTGAYWRSWYESPTFEQDLENLFKQLEPLYQNLH
AFVRRKLYNYYGPKYINLKGPIPAHLLGNMWSQTWNNIYNMMIPFPDKPNVDVTDTMVAK
GYNATHMFRVAEEFFTSLGLLEMPPEFWDKAMLEKPTDGREVLCHASAWDFYNRKDFRIK
QCTTVTMEQLFTVHHEMGHVEYYLQYKEQPVSFRSGANPGFHEAVGDVLSLSVSTPKHLH
TIGILEQRTDDAESDINYLLKMALEKIAFLPFGYLIDQWRWGVFSGRTPPERYNAEWWYL
RTKYQGICPPTRRTEEHFDAGAKYHIPGNTPYIRYFVSFILQFQFHEKLCQEAGHTGTLH
KCDIYRSKEAGAVLEKVLKAGSSKPWTEVLQEALGTNRMDASPLMSYFEPVTTWLQEQNA
KMGETLGWPDFNWVPPVPEGYPEDIGKITDEMLAKQFLEEYNSTAEEVWNAYTEASWAYN
TDITEANKEIMLQTNLEMANHTKVYGLQARKIDTSDFQDESVKRILTKLSDLERAALPEE
DLIEYNNLLASMETLYSVATVCKDESKCLPLDPNLNKIMAESRDYDELLFAWQGWRNASG
RELHNSYKRYVELANLAAKSNGHTDNGGFWRSLYETPTFEEDLEALWKDLEPLYLNIHAY
VRRALYKKYGPEHINLKGPIPAHLLGNMWAQTWSAIMDLVIPYPDATQVDATPAMIAQGW
DPKRMFEESDRFFTSLGLLPMPPEFWNKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQC
TVVTMDDLITVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVLALSVSTPKHLKSI
GLLDKVEDNKESTINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRISSSEYNKEWWNLRM
KYQGLCPPVPRTEEDFDPGAKFHIPANVPYVRYFVSFVIQFQFHKALCEAAGQPAPLHNC
DIYQSKEAGKLLGDVMKMGFSKPWPEAMTLITGQPKMSVQPLMEYFQPLIEWLVEENKKN
GDVLGWPEYDWTPYKITSVMDEKPKAISFLGLSVDEGGAVAGQWILLVLSIVFLLGIIYL
VYRYRKTKRLQDKSISQMELK
NT seq 3846 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgggcagtggtgctgctgactctcatcagcacgagcgcagctctgaaacccgag
tggatcccgggggattattctatgacagaggcaggggctgagagcttcgtgagcgactac
aactcaaccgccgaggaggtcttctacttcagcacagaggccagctggaactacaacacc
aacctgacagatcacaattcacagctgcagattgctgcatctttggaggagcaggctttc
acagaagcatggggtcaaaaagcaaaggctaccttcagtgattctctcatggataccttc
actaatccagacctgaagaaaatcatcaataatatcaatgttctgggacccgccaatctc
ccaactgctgagagagagaagtacaataccattctgagccagatggacagcatctactca
actgcaaaggtgtgtccttcagaggaatgctggtctttggagcctgagctcacagaaatc
atggctacctcaagaagctataagaggcttctgtatgcctgggaaggctggcacaacgcc
tcaggggtcccactcagatccctctactctgagtttgtggagctcagcaacaaggcatct
cggatggacggcgttaacgatacaggcgcatactggcgttcctggtacgaatctccaacc
tttgaacaagacctagagaatctgtttaaacagctggaacctctctaccaaaacctgcat
gcctttgtccgccgaaagctctacaactactatggtcctaaatacatcaacctcaagggt
cccatccccgcccacctcttgggcaacatgtggtcacaaacgtggaacaacatctacaac
atgatgattccttttcctgacaagcccaatgtagatgtgacggacaccatggttgctaaa
ggttataatgccactcacatgttccgggttgccgaggagttcttcacctctctgggtttg
ctcgaaatgcctcctgagttttgggacaaggccatgctggagaaacccactgatggaagg
gaggtgctctgccatgcctctgcctgggacttctacaaccgcaaagacttcagaatcaaa
cagtgcaccactgtgactatggagcagcttttcaccgtgcatcacgagatgggccatgtg
gaatattacctccagtacaaagagcagccggtcagcttcaggagcggagccaatcctggc
ttccatgaggccgtaggggatgtgctgtctctgtctgtctccacacccaaacatctccac
actatcggcatcctggaacaacggaccgatgatgctgagagtgacatcaactacctgttg
aagatggctttggaaaagatcgccttccttccttttggatatcttattgatcagtggcgc
tggggtgtgtttagtggacgaacaccgccagaacgttacaatgcagaatggtggtacctc
aggacaaaataccaaggcatctgtccaccaaccagacgtactgaagagcattttgatgct
ggagcaaaatatcacattcctggaaacacaccgtacatcagatactttgtgagcttcatt
ctgcagttccagttccatgagaaattatgtcaggaggctggacatactggaactctgcac
aaatgcgatatctacagatccaaagaggctggagctgttttagagaaagtcttgaaggct
ggctcttcaaagccttggacagaggtgctacaagaggctcttggcactaacagaatggac
gccagccccctgatgagctattttgagccagttactacctggctgcaggaacagaatgcg
aaaatgggagagacgctgggctggcctgattttaattgggtgccaccagtaccagaaggc
taccctgaagacatcggtaaaataacagatgagatgctggccaaacagttcttagaggaa
tacaacagcacagccgaggaggtctggaacgcttacactgaggcctcctgggcctacaac
actgacatcactgaagccaacaaggagatcatgctgcaaacaaacttggagatggccaac
cacacaaaggtctatggactacaggcccgtaagatcgacaccagtgacttccaggatgag
tcagtgaagagaatcttgacgaaactgagtgaccttgagagagctgcgcttcctgaagaa
gatctcatagagtacaataatttgctagcatccatggagaccctgtacagcgtagccaca
gtctgcaaggatgaatcaaagtgtctacctttagatccaaatttgaataagatcatggcc
gagtccagggattatgacgagctgctgtttgcctggcagggttggcgcaatgcctcgggc
agagagctccacaacagctacaagagatatgtggagcttgccaacttagctgcaaagagc
aatggtcacacggataatgggggattttggcgttccctgtatgagacccccacctttgaa
gaggatctagaggccttgtggaaagatctagagccgctctacctcaacattcatgcttat
gtgcgcagggcactgtacaagaagtatggaccagaacacatcaaccttaaaggaccaatt
ccagctcatctgctcggaaatatgtgggcccaaacgtggtctgctatcatggaccttgtc
attccgtaccctgatgccacacaagtggatgccacgccagccatgattgcccaaggttgg
gaccccaaacggatgttcgaggaatcggaccggttcttcacttctctgggtcttctgccc
atgcctcctgagttctggaacaagtccatgctggaaaagccaacagatggacgtgaagtg
gtctgtcacgcatctgcttgggacttctacaaccgcaaagacttcaggatcaagcagtgc
acagtggtgaccatggacgacctcatcactgtgcaccatgagatgggccacgttcagtac
ttcctgcagtataaggatcaacccatctctttccgcgacggcgccaaccctggattccat
gaggccattggtgatgttttggccctgtcagtttccacacctaaacatcttaagagcatt
ggcctgctggacaaggtggaggacaataaagaaagcaccattaacttcctgatgagcatg
gccttggataagattgccttcctgccttttggctacctgatggaccagtggaggtggaag
gtatttgatggaaggatctcaagctcagagtacaacaaagagtggtggaacctgagaatg
aagtaccagggattgtgtccacctgtaccgcgcactgaggaagacttcgaccctggtgca
aagttccacatcccagctaatgtgccctacgtcaggtactttgtgagttttgtaatccaa
ttccagttccacaaagccctgtgtgaagcagccggtcagccagctccactccacaactgt
gacatctaccagtccaaagaagcagggaaactcctgggtgatgtgatgaagatgggcttc
agtaaaccctggcccgaagccatgactttgattactggccagcccaaaatgtcagtccag
cctctgatggaatacttccaaccgctcatcgagtggctggtggaggagaacaaaaagaat
ggtgatgtcctgggatggccagagtacgattggacgccttacaaaatcacttcagtgatg
gacgagaagccaaaagcaatcagtttcctgggtttgagtgtggatgagggaggcgctgtg
gcgggacagtggattctcttggttctgagcatcgtcttcctgcttggcatcatctattta
gtctacagatacaggaagactaaacgcttacaggacaaatcaatatctcagatggagctc
aagtaa

DBGET integrated database retrieval system