KEGG   Sinocyclocheilus anshuiensis: 107667371Help
Entry
107667371         CDS       T04917                                 

Definition
(RefSeq) serine protease 27-like
Organism
sanh  Sinocyclocheilus anshuiensis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 325 aa AA seqDB search
MWRLTCVTLTLLMCAKGSHSQLNVCGQAPLNTRIVGGVNAPDGSWPWQVSLHRSGYHFCG
GSLINNEWVLTAAHCLPGVSASSLRVYLGRRTQQGVNANEISRNVTTIIVHTSYDRNTNN
NDIALLRLSSAVTFNNYIRPVCLAAQNSVFPSGTSSWITGWGDVQSGVSLPSPGILQETM
IPVVDNVQCNTLLGSGSVTSNMMCAGLTQGGKDTCQGDSGGPMVSQQCTVWVQSGITSWG
HGCADPNSPGVYTSVSRYQSWITNNIGQNLPGFVTFSPSNSCSASLTSTSCRGRCNEKYN
SHFRCNCNTNCILNCCKDYRQHCAM
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtggagattaacatgcgttacgttgaccctgctcatgtgtgccaaaggttcacattct
cagctgaatgtttgtggacaggctcctctaaacacccgtattgttggtggtgtgaacgca
cctgatgggtcgtggccgtggcaggtcagtctgcaccgttctggatatcatttttgcgga
ggctccctcatcaacaatgaatgggtgctgacggcagctcactgtttacctggtgtcagc
gcatccagtctgcgtgtgtatttgggaaggaggacacagcagggagtcaatgccaatgaa
atcagcagaaatgtcactacgatcattgtccacacctcctacgacaggaacacaaataac
aatgacatcgctctgctccggctgtcctccgcagtcaccttcaataactacattagaccc
gtgtgtctggcggcccagaacagcgtcttcccttctggcaccagcagctggatcacaggc
tggggagatgttcaatctggagtgagcctaccttctcctgggattctgcaggagactatg
attccagtggtggacaatgttcaatgtaatactctgctgggttctggatctgttaccagc
aacatgatgtgtgctggtttaacgcagggaggcaaagacacctgccagggggattctggt
ggtccgatggtgagtcagcagtgtacagtgtgggttcagtctggtatcaccagctggggt
catggctgtgccgatcccaactctcctggagtttacaccagcgtgtctcgatatcagagt
tggatcacaaacaacattggacagaacctgccgggatttgtcaccttcagtccctctaac
tcatgctctgccagcctaacctcaacctcctgtagggggagatgcaatgagaagtacaac
agtcacttccgctgcaactgcaatactaactgcattttaaactgctgcaaagattacaga
cagcattgtgccatgtga

DBGET integrated database retrieval system