KEGG   Sinocyclocheilus anshuiensis: 107671285Help
Entry
107671285         CDS       T04917                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sanh00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    107671285
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107671285
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107671285
   00430 Taurine and hypotaurine metabolism
    107671285
Enzymes [BR:sanh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107671285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 593 aa AA seqDB search
MAASSSSSSSSSSGGDPDPNSTDLRPPSSNYDWSGVAHGCTRKLGMKICGFLQKNNNVDD
KSRIVRFCNEKQPKSILTRDNERDPRFRRTETDFSNLYARDLLPAKNGEEYTMQFLLEVV
DILTNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELCDQPESLEQILVDCRDTLKYGVR
TGHPRFFNQLSSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIIGWPN
GEGDGIFSPGGAISNMYSVMVARYKHYPEVKIKGMAAAPRLVLFTSEHSHYSIKKASAVL
GFGTENLILLRTDERGRVIPADLEAKVIDAKQKGFVPVFVNATGGSTVYGAFDPINEIAD
ICEKYNMWLHVDGAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVPLQCSAILVREK
GLLQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKSKGTIGFEKHID
RCLELSEYLYHKIKNREGYEMVFQGEPQHTNVCFWYIPPNLRLLPDGEEKRQRLHRVAPK
IKAMMMECGTTMVGYQPQGDKVNFFRMVVSNPAVTRSDIDFLIDEIERLGQDL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttcttcctcctcctcctcctcttcctcctctggcggcgatccggatcccaac
tcgacagatttacggccaccctcctcaaactatgactggagtggagtcgctcatggatgc
accaggaaacttggaatgaagatatgcggatttttgcagaagaataataatgttgacgac
aagagccgaattgtcaggttttgtaacgagaagcagcccaagagcattttaacacgggac
aacgagcgagaccctcgcttcagacgcacagagacagacttctccaatctatatgcaaga
gatctgcttcctgctaaaaatggtgaggagtatacgatgcagttcctgttggaggtggtg
gacatcctcacgaactatgtgcgcaagaccttcgacagatccacaaaagtgctggacttc
catcatccgcaccagctgctggagggaatggagggcttcaacttagagctgtgtgatcag
ccggagagtctggagcagatcctggtggactgcagggacacgctcaaatacggcgtccgc
acaggtcatccaaggttttttaaccagctgtcttcaggtctagacatcattggtttagct
ggcgagtggctgacctctactgccaacactaacatgttcacatatgagattgcacccgtg
tttgtactgatggaacagctcaccctgaagaaaatgcgagagatcattggctggccaaat
ggagagggcgatggcattttctcaccaggaggagcgatctcaaacatgtacagcgtgatg
gtggcacggtacaaacactaccctgaggttaaaatcaaaggcatggcagcggctcccaga
ctagtgctgttcacctctgaacatagtcactactctataaagaaggccagtgcagtgctg
ggtttcggcacagagaatctgatcctgctgaggacagatgagagaggtagagtgattccg
gctgatctggaggccaaagtcattgatgccaaacagaaggggtttgtgccagtgtttgtg
aatgctacaggtggatctacagtgtatggagcctttgatccaatcaatgagatcgctgac
atctgtgagaaatacaacatgtggcttcatgttgatggagcgtggggtggaggtttgctg
atgtctagaaaacacagacacaaactgaatggcattgagagagcaaactctgtcacatgg
aacccacacaagatgatgggtgttccgctgcagtgctctgccattctggtccgagagaag
ggtcttctacagggctgcaactccatgtgtgctggttatctttttcagccggataagcag
tatgatgttacctatgacacaggggacaaagccatacagtgtggccgccatgtagacatc
ttcaaattctggctcatgtggaagtcaaagggcactataggctttgagaagcacattgac
agatgtctggagctgtctgagtatctctaccacaagataaagaaccgagaaggatatgag
atggtgtttcaaggggagccccagcacaccaatgtgtgtttctggtacattcctccaaac
ctgcggctcctgccagatggagaggagaaaagacaacggcttcatagggttgcccccaag
atcaaggcaatgatgatggagtgtgggacaacaatggtgggctatcagcctcaaggtgat
aaggtcaacttcttcagaatggttgtctctaatccggctgtaaccaggtctgacattgac
ttcctgatcgatgagattgaaagactgggacaggatttatag

DBGET integrated database retrieval system