KEGG   Sinocyclocheilus anshuiensis: 107674364Help
Entry
107674364         CDS       T04917                                 

Definition
(RefSeq) histone deacetylase 6-like isoform X1
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107674364
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107674364
Messenger RNA biogenesis [BR:sanh03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107674364
Membrane trafficking [BR:sanh04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    107674364
Chromosome [BR:sanh03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     107674364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1091 aa AA seqDB search
MDPVPDSKGSTRSPRGTSETKRENNNPNQKKNLQEARRKGRMDRSKEEEEMSSELKNLDV
RGKTKATGTGLVYVDAFTRFHCLWDASHPECPARVSAVMEMLETEGLLGRCVQVEARAVS
EDELLLIHTKAYVELMKSTQKMTEEELKTLAHKYDSVYLHPEFFASACLAVGSVLQLVDK
VMTSQLRNGFSINRPPGHHAHAEKMNGYCMFNNLAIAARYAQKQHGVKRVLIVDWDVHHG
QGIQYIFEEDPSVLYFSVHRYEDGSFWPHLKESDSSSVGSGAGQGYNINLPWNKIGMEDG
DYVTAFQQLLLPVAYEFQPQLVLVAAGFDSVIGDPKGEMRVSPQCFSILTHMLKGVAQGR
LVLALEGGYNLQSTAEGVCASVRSLLGDPCPHLTSPGTPSESALKSISESISALYPFWKS
LQTFEGGPLSDVTPLPAPVCAEVKVSSPITGLVYDQRMMLHHNMWDGHHPELPQRISRIF
CQHEELGLLSRCLQIPARLATEEELALCHSSEHISTIKSTEHMKPRDLHRLGNDYNSIYI
CNESYTCALMAAGSCFNSVQAIITGHVRNGVAIVRPPGHHAEKDTACGFCFFNTAALTAR
YAQSITHESLRVLILDWDVHHGNGTQHIFEEDDSVLYISLHRYEDGTFFPSSEDANYDKV
GQGNGTGYNVNIPWNGGKMGDPEYMAAFHHIVMPIAREFAPELVLVSAGFDAARGDPLGG
YQVTPEGYAHLTHQLMCLAAGRVLVILEGGYNLTSISESMSMCTSMLLGDSPPSLDHLPP
PKTSATVTINNVLRAHAPFWSSLRIQIPESLRLALPSPKSKGKRASAGKSKKSPRQSTQS
PGQTPQHLEESGLDELSKDLLSLNLNTSTSSNPSPASVPIGGARRKVKPNPQRDSAGRES
DSPLKRTSEKARVGDGTHAEITAVKAETPDRTIPESVVSGKSAAVDDQESSVLEAAGGHT
TMMSVLESVFGAQATDLDTMYVVDPLSWCPHLESVRPVPAGGIDVFLPCEECGGDTENWI
CLFCYKVLCGRYVKQHMVTHGQVSGHPMVLSFADLSVWCYACESYVHNKVLHEAKSAAHL
VKFGEEIPPFS
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgttccagattccaaaggttctactcgatcaccgagaggaacatctgaaacc
aaaagagaaaacaacaatccgaaccagaagaagaatctacaggaggcgcggaggaagggc
agaatggatcggagcaaagaggaggaggagatgagcagtgaactcaaaaacctggatgtt
cgtggtaagactaaagcaacaggaacaggtctcgtctacgtagatgcctttactcgcttt
cactgcctctgggatgccagtcacccggagtgtccagcaagagtgagcgctgtgatggag
atgctggagacggaaggtctgctgggacgctgcgttcaagtagaggccagagctgtgtca
gaagatgagctgttactcattcatacgaaggcgtatgtagagctgatgaaatccacacag
aaaatgacagaggaggagctgaaaactttggctcataaatatgattctgtctacctgcat
cctgaatttttcgcctccgcctgtctggcggtgggatcagttctccagctggtggataaa
gtgatgacatcacagctgcgtaatggcttctccatcaacaggcctcctggtcaccacgct
catgcagagaagatgaatggctactgtatgtttaataatctggccatagcagcacgctac
gcacagaagcagcatggagttaaacgagttctgattgtggattgggatgtgcatcacgga
cagggaatccagtatatttttgaagaggatcccagtgtgctgtatttctccgtgcacaga
tatgaagatggctcgttctggccgcatctcaaggagtctgacagcagttcggtgggttca
ggagcaggacagggctacaatatcaacctgccctggaacaagatagggatggaggatgga
gattacgtcacagctttccagcagctcctgcttccagtggcgtatgagtttcagcctcag
ctggtgttagtggcggccggctttgactctgtgattggtgacccaaagggtgagatgcga
gtgagtccacagtgtttctccatcctgacccacatgctgaaaggtgtagcacagggtcga
ctcgtgctggctcttgagggtggatataacctccagtccacagcagagggtgtttgtgct
agtgtgaggtcactgctgggtgacccttgccctcatctgacctctcctggcactccgagt
gaaagtgctctgaagtccatctcagagtccatctcagccttgtatccattttggaagagt
cttcagacttttgagggtggtcctctgtcggatgtcactcccctgcccgctccagtgtgt
gcagaagtgaaggtttcctctccgatcactgggctggtttacgaccagagaatgatgctt
catcacaacatgtgggatggtcatcatccagagctccctcagagaatttctcgcatcttt
tgccagcatgaggagttgggtctgctgtcccgttgccttcagataccagctcgcctagca
acagaagaagagctggcactctgtcacagttctgagcatataagcactataaagagtaca
gagcacatgaaacccagagatctgcaccgtctgggaaacgattacaactccatctacatc
tgtaatgagagctacacctgtgccctgatggccgctgggtcgtgttttaactctgtacag
gccataatcacaggccacgtgagaaatggcgtggccatagtccgtcctcctggtcatcat
gcagagaaagacacagcttgtggtttctgtttctttaatacggctgctttgaccgcacgc
tatgcccagagcatcactcacgaatccctgcgtgtcctcatcctggattgggatgttcac
catggaaacggcacacagcacatctttgaggaggatgacagtgttctgtacatctccctg
catcgctacgaagacgggacattcttccccagttcagaggatgctaactatgataaggtg
gggcaggggaacggcacaggatacaatgtcaacatcccctggaatggaggaaagatggga
gacccagaatacatggcggctttccatcacatagtgatgccgatagccagagagtttgcc
ccagagctggtgctggtgtctgctgggtttgatgcagcacgaggtgatccgttaggaggg
tatcaggtgaccccagagggctacgctcacctcacccatcagttaatgtgcctggctgca
ggaagagtgctagtcatactggagggaggatataacctcacctccatctctgagtcaatg
tccatgtgcaccagtatgttgctgggagactctcctccgtctctagaccatctgccccct
ccgaagaccagcgccactgttaccattaacaatgtcttgcgtgcacacgcccccttttgg
agctccttgagaatacagattccagagtcacttcgtttggctttgccgtctcctaaatcg
aaaggcaagcgggcatcagcgggcaagagcaagaaatctcctcgccagtccacccagagt
cctggacagacaccacagcatcttgaggaatccggccttgatgagctcagtaaggacctg
ctctctctgaatctcaacacaagtacctcatctaaccccagcccagcatctgtccccatt
ggaggagccagacggaaggtgaaacccaacccacagagggattcagcaggccgggagtca
gattcacccctaaaacgcacgtcagagaaagccagagttggagatggcacgcatgcagag
attacagctgtaaaagcagagacacctgaccggacaatcccagagtctgtggtctctgga
aagtcagctgccgtggatgatcaggagagttcagtgctggaagctgctggtggtcacacc
actatgatgtcagtcttagaaagtgtctttggagcacaagccacggatttggacaccatg
tatgtggtggacccgttgtcatggtgcccacacttggagtcagtgcgaccggtgcccgca
ggtggcatcgatgtcttcctgccgtgtgaagagtgtggaggtgataccgaaaactggatc
tgcctcttctgctacaaggtgctctgcgggcgttatgtgaagcagcacatggtgacccac
gggcaggtgtcgggtcaccctatggtgctgagcttcgctgacctttctgtctggtgctac
gcttgtgagtcatacgtccacaacaaggtgctccatgaagccaaaagtgccgctcacctt
gtgaagtttggagaggagattcctcctttcagctaa

DBGET integrated database retrieval system