KEGG   Sinocyclocheilus anshuiensis: 107679310Help
Entry
107679310         CDS       T04917                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1-like
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sanh00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107679310
Enzymes [BR:sanh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107679310
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107679310
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107679310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 107679310
NCBI-ProteinID: XP_016330321
LinkDB All DBs
Position
Unknown
AA seq 421 aa AA seqDB search
MAENLKAQVCRVACIATEGQLEVICREQGVKCDELGINKHNLCDYEVEYLCDYKKKVITN
GKRQTIQELYLVKWKGYPESSNTWEPRRNLKCIDLLNQFWEDLNAEMQRQKKRAAPRRLD
PATVSQLIQRAKLRQTLKRWETHLNSLGTHKGHIYVRNQVDLEGPPKNFTYINDYKVGDG
IMLNEVSVGCECTDCLGNPVEGCCAGASQHKFAYNELGQVRIRPGLPIYECNKRCHCGID
CPNRVVQRGIQYSLCIFKTDNGRGWGVKTMERIRKNTFVMEYVGEIITTEEADCRGHIYD
KEGATYLFDLDYVDDEYTVDAAHYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFA
TRGIKAGEELTFDYKMKIDPVDAESTKMDSNFSLTGLPGSPKKRMRVECKCEVPTCRKYL
F
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttgaaagctcaggtttgtagggtagcatgcatcgctactgaaggccag
ctggaggtgatctgtcgagagcagggggtgaagtgtgatgagctgggcatcaacaagcac
aacctgtgcgattatgaggtggaatatctctgtgactacaaaaagaaagttatcaccaat
ggcaagagacaaacaatacaggagttatacttggtgaaatggaagggctacccagaatcc
agcaacacatgggaaccacggaggaacctgaagtgcatagatcttctcaaccagttctgg
gaggacctgaatgcagagatgcagagacagaagaaacgtgctgcccctcgtcgcctagac
cctgccactgtgtcacagctcatccagcgggcgaaactccgacagacccttaaacggtgg
gagacgcacctcaacagcttgggcacccacaagggccacatctacgtccggaaccaggtc
gacctggaaggcccgcctaagaacttcacctacataaatgactataaagtcggtgatggg
ataatgctgaatgaggtatccgtgggctgcgaatgtacagactgccttggcaaccctgtg
gagggatgctgtgccggagcgtctcagcacaagtttgcttacaatgagttaggccaggtc
cgcatccggcctgggttgcccatttacgaatgcaacaagcggtgccattgcgggatcgac
tgccccaacagagtggtgcagaggggaattcagtattccctctgcatttttaagacagac
aatggaaggggatggggggtaaagaccatggagcgcattcggaagaacactttcgttatg
gagtacgtcggggagatcattacaacagaagaagcagattgcagaggtcacatatacgat
aaagaaggcgccacctatctttttgacctggattatgttgacgacgagtacaccgtggat
gctgctcactatggaaacatctctcactttgtcaatcacagttgtgaccccaacctccag
gtatataatgtgtttattgataacctggatgagcggctgccgcggatagcattctttgcc
acgcgtgggataaaggcaggagaggagctcacatttgactacaaaatgaaaattgatcca
gttgatgccgagagcacgaagatggattctaatttcagtctgacgggactcccaggctcc
cctaagaagcgcatgcgcgtagagtgcaaatgcgaggtaccaacatgtcgaaagtacctc
ttttag

DBGET integrated database retrieval system