KEGG   Sinocyclocheilus anshuiensis: 107690246Help
Entry
107690246         CDS       T04917                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial-like
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sanh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    107690246
   00650 Butanoate metabolism
    107690246
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107690246
   00280 Valine, leucine and isoleucine degradation
    107690246
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107690246
Enzymes [BR:sanh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     107690246
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     107690246
Amino acid related enzymes [BR:sanh01007]
 Aminotransferase (transaminase)
  Class III
   107690246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 500 aa AA seqDB search
MASSLLTRQLAISLQQNLRLAAPGSRYVSKTATKTVSEFEYDAPSMKTAVPGPKSQELLR
QLGEIQNVGAIHFFCNYEESRGNYLVDVDGNRMLDVYTQISSIPIGYNHPALMKVMTNPN
NVSAFVNRPALGILPPENFPDKLIESVLSIAPSGMTRVQTMACGSCSNENAFKTMFIWYR
NKERGYANPSEQEVGTCMINQSPGCPDLSILSFMGAFHGRTLGCLATTHSKVIHKLDIPS
FDWPIAPFPKLQYPLEEFVRENAQEEARCLEEVEDLIVKWRQKGKPVAGIVIEPIQAEGG
DNHASPDFFIKLRNIARKHGCAFHVDEVQTGGGTTGKFWAHEHWGLDDPADVVSFSKKLL
TGGYYHRDELQPDKPYRIFNTWMGDPSKNLFLSEVLNVIRRENLLEEVTRSGKTLLQGLY
ALQTQYPHILSRARGQGTFCAIDACNDATRDSIMIKARNKGLFMGSCGEKTIRFRPTLVF
KEYHVHQLLNILNDVLAEHK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcactcctgacccgccagctggccatctcccttcagcaaaacctgcgactc
gccgctccaggttccagatatgtcagcaaaactgccacaaagacagtttcagagtttgaa
tatgacgccccatccatgaaaactgctgtgccaggtccaaagtcccaggagctgctgaga
caactcggagagattcagaatgttggagcgattcatttcttctgcaactatgaggagagc
aggggaaactacctggtggacgtggacggcaaccgaatgctggacgtgtacacacaaatc
tcctccatccccatcggttacaatcatccagcattaatgaaagtgatgaccaatccaaat
aatgtgagtgcatttgtcaaccggccggcgcttggtattctgccacctgagaactttcca
gacaaactgatcgagagcgtgctgtcgattgcccctagcgggatgacgcgagtacaaacc
atggcctgtggttcctgctccaatgagaatgctttcaagaccatgtttatctggtacaga
aataaggagagaggatatgccaacccctctgagcaggaagtcggcacttgcatgatcaac
cagagtcctggatgcccagatttgagcatcttgtctttcatgggagctttccatgggaga
actttgggttgcctggctacaacacattccaaagtcattcacaagctggatataccgtcc
ttcgactggcccatcgcacccttccctaaactgcagtaccctctggaggagtttgtgagg
gagaacgcccaggaagaggcccgctgcctggaggaggttgaggatctcatcgtgaagtgg
aggcagaagggcaaaccagtggctggcattgtgatcgagcccatccaggcagagggaggg
gacaaccacgcttcacctgacttcttcatcaaactgagaaatattgcacgcaagcatggc
tgtgctttccacgtggatgaggtgcagacaggtggaggaacaacaggcaagttctgggcc
catgagcattggggcctggacgaccctgctgatgttgtctccttcagcaagaagctgctg
acaggaggatactaccacagggatgaactgcaaccagacaaaccctacagaatcttcaac
acgtggatgggagacccctcaaagaatctgttcttatcagaggtgcttaatgtgatccga
agagagaaccttctggaggaggtgacgcgctcagggaagactcttctacagggcctttac
gcactgcagacccagtatcctcatatcctgagcagagcccgcggccagggtacattctgt
gccatagatgcctgcaatgatgccacacgcgacagtatcatgattaaagccaggaacaag
ggtctgtttatgggttcctgtggagaaaagaccatccgtttccgtcccactttggtcttc
aaggagtaccatgtccatcagctcctgaacatcctgaacgacgtcctggctgagcataaa
tag

DBGET integrated database retrieval system