KEGG   Sinocyclocheilus anshuiensis: 107692994Help
Entry
107692994         CDS       T04917                                 

Definition
(RefSeq) cell division cycle protein 23 homolog
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:sanh00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107692994
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    107692994
   04114 Oocyte meiosis
    107692994
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107692994
Ubiquitin system [BR:sanh04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107692994
Chromosome [BR:sanh03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    107692994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 579 aa AA seqDB search
MAATRSSEFGDLVQIKKQLISIIAQCKERGLVHSVKWASELAFSLDPLPLNEIPPALELT
EEDARDLDALCLAKSYFELKEYDRAAYFLRGCRSQKAYFLYMYSRYLSGEKKKDDETVDS
LGPLEKGQVRNEALRELRVELSKKHSAGELDGFALYLYGVVLRKLDLLKEAVEIFVAATH
ALPLHWGSWLELCNLITNIEMLKSLSLPECWVRDFFMAHMFTELQMIKEALQKYQSLMEA
GFAKSTYIISQIAVAYHNIRDIDQALYLFNELREQDPFRIENMDTFSNLLYVRSMKPELS
YLAHNLVEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRCLGAWTLMGHEYME
MKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYSLYYYRKAHQLRPNDSRMLV
ALGECYEKLSQQVEAKKCYWRAYSVGDVERMALLKLAKLHEQLNESDDAAQCYIIYIQDI
FSCGEQLEHAEVSTALRYLGQYYFKNKLYDEASLCAQRCCDYNDAREEGKALLRQISAVR
EQGEPSSTDLSLPCVFNPLSNNTTPIRRVSPLDLSSVTP
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggcggctacccgcagcagcgagttcggcgacttggttcaaattaaaaaacaacttatt
tctattatagcgcagtgtaaggaaagaggactcgtccacagtgtgaaatgggcatcagaa
ctggctttttctttggatccactccctctgaatgagatccctccagcgctggagctcacc
gaggaggacgcccgggatttggatgccctgtgtctggccaaatcatactttgagctgaag
gaatatgatcgagctgcatattttctccgcggctgccggagtcagaaagcatattttctc
tatatgtattcgcgctacctatcaggcgaaaagaagaaagacgacgagaccgtcgacagc
ctgggtcctctggagaagggtcaggtccgaaacgaagccttgcgagagctcagggtggag
ctgagcaagaaacacagcgccggagagctggacggatttgcgctctatctttatggggtg
gttctgcggaagctggatttgctgaaggaggcggtggagatctttgtggcggcgacacat
gctctgcctctgcactggggatcctggctggagctctgcaatctcatcaccaacatcgaa
atgctgaagtccctgtctctgccggagtgctgggtgagggatttcttcatggcacacatg
ttcaccgagctgcagatgatcaaagaggcgctgcagaaataccagagcctcatggaagca
gggtttgccaaaagcacatacatcatctcccagatcgccgtggcttaccataacatacga
gatattgatcaagccttatatctgtttaatgagctccgggaacaggatcctttccgcatc
gaaaacatggacaccttctccaacctgctttatgtgcggagcatgaagccggagctcagt
tacctggcacacaatctggtggagatcgataagtaccgcgtggagacgtgctgcgtcatc
ggtaactactacagtctgcggtctcagcacgagaaggccgctctgtatttccagcgggct
ctgaagctgaatccacgctgtctgggggcctggaccctcatgggtcacgagtacatggag
atgaagaacacctccgccgccatccaggcctacaggcatgcaattgaagtgaacaaaagg
gactaccgggcctggtacggactcggacagacctacgagatcctcaagatgcccttctac
tcgctctactactacagaaaagctcatcagctgaggccgaacgactcacgcatgctcgtc
gctctcggggaatgttacgagaaactgtctcagcaagtggaggccaaaaagtgttactgg
agggcgtattcggtcggcgatgtggagagaatggctcttctgaagctggctaagcttcac
gagcagctgaatgaatctgacgacgctgcacagtgctacatcatctacatccaggatatt
ttctcgtgtggggagcagctggagcacgctgaggtcagcaccgctctgaggtatctgggt
cagtactacttcaagaacaaactgtacgacgaggcgtctctctgcgctcagcgctgctgc
gattataacgacgcacgagaggaaggcaaggctctgttgagacagatctctgcggtgcga
gagcaaggcgagccgtcatcgacagacctgtctttaccctgcgtcttcaacccgctgtct
aacaacaccacacccatcaggagagtgtctccactcgacctgtcctccgtcacaccctga

DBGET integrated database retrieval system