KEGG   Sinocyclocheilus anshuiensis: 107697479Help
Entry
107697479         CDS       T04917                                 

Definition
(RefSeq) coagulation factor XIII A chain-like
  KO
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
Enzymes [BR:sanh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107697479
Cell adhesion molecules and their ligands [BR:sanh04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     107697479
   VLA-9
     107697479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 742 aa AA seqDB search
MADQEARENPTPAAPPAAARPKRVSHRGRTAGAKVSSNQQEGKVEEFEPFMLLPRGPPPL
KEFLDIWDVDVLKRPQEINKQGHHTHLYSSDFLIVRRTLEFQIKITFDRPYKPAEDKFAV
EFVIGPSPQYSKGTYIPVFPSEERQSVWRGRIVETSDNVVTMGITTSPECIVGKYMIYIG
VVTPYGIRRTRRDPSTDIYILFNPWSPADPVFLDDEEEREECVMNELGIIYHGAYDDVSE
RAWNYGQFEFGVLDACLFIMDKADMPLSNRGDVIKVTRVASAMLNSRDDDGVLVGNWSGD
YTYGVPPTSWTGSVEILLDYAGSRGTPVCYAQCWVYAAVFNTFLRCLGIPGRVVTNFFSA
HDNDGNLKMDIILDENGKLDRNRTKDSIWNYHCWNECFMARSDLPPGFGGWQVVDATPQE
TSDGMFRCGPASVAAVKHGQICYPFDAPFVFAEVNSDVIFYRRQKDGTLEVVKVNPTHVG
RMVLTKAVLHDGRRDITDQYKFPEGSPEERRVLEKAEEFGCQREKASLPQSDVEVEIPTL
DVRVGDNFDVTLQFKNHSDQRRTADVYVTGTVVYYTGVPSAEVVFKTPKVKLDPLQNKDE
KVLVRGEDYMHKLVEQANIHFITTGKIKETGQIITAMKVITIHNPKLIVKVTGSPRVSEE
MYVSVEFTNPFKFNLENVHLRMEGPGIMPFKRKQYSLIAPGTSITWTETFSPRRAGSTKL
IASLDCAALRQVYGETELTIQQ
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcaagaggctcgagagaacccgacccctgctgccccaccggccgccgcgcgc
cccaaacgcgtgtcccaccgcggacgcacagcaggagccaaagtcagctccaatcaacag
gaggggaaagtggaggagttcgagcccttcatgttactgccccgaggaccgccaccgctt
aaggagtttctcgatatctgggatgtcgatgttctcaaacgacctcaagagatcaataaa
caagggcaccacacgcacctgtactccagcgacttcctcatcgtgcggcgcactctggag
tttcagatcaagattaccttcgatcgaccctacaaaccggctgaagacaagtttgcggtt
gagtttgtcatagggccgagtcctcagtacagtaagggcacctacattcccgttttcccc
agtgaggagcgtcagagtgtttggagaggccggatcgtagagaccagcgacaatgtcgtc
acaatgggcatcaccacctcaccagagtgcattgtgggaaaatacatgatatacatcggt
gtggtgaccccctacggtattcgcaggaccaggagggacccgagcacagacatctacatc
ctcttcaacccgtggtcaccagctgatcctgtgttcctggatgatgaggaggagcgtgaa
gagtgtgttatgaatgagctggggatcatctatcatggcgcgtatgatgatgtgtctgaa
cgcgcatggaactacggacagtttgagtttggtgtcctggatgcctgtctgttcattatg
gataaagcagatatgccgctgtccaaccgtggggacgtcattaaagtgacccgcgtcgct
tcagccatgctgaactcacgcgatgacgacggcgtgttggtggggaactggagtggcgat
tacacatacggtgtcccgccgacgtcctggaccggcagcgtggagatcctcctggactac
gccggcagcaggggaacacccgtctgctacgcccagtgctgggtctacgctgctgtcttc
aacaccttcttgcgttgtctcgggatccccggcagggtcgtgacaaacttcttctctgct
cacgacaatgacggcaaccttaagatggacatcatcctggacgaaaatggaaaactggac
cggaaccgcaccaaggactccatctggaattatcattgctggaacgagtgcttcatggca
aggtctgatctgcctcctggtttcggaggatggcaggttgtggatgctacgccacaggag
acgagcgatggtatgttcaggtgtggacctgcatcagtagctgccgtaaaacacggccag
atctgctacccgtttgatgccccttttgtgtttgctgaggtgaacagtgacgtgattttt
tatcgtagacaaaaagacggcactctggaagtagtgaaggtgaatcccactcacgtgggc
cgcatggtgctgaccaaagccgtgctgcacgatggacgtcgagacatcactgatcaatac
aagttccctgaagggagcccagaggagcggcgtgtgctggagaaggccgaggagttcggc
tgtcagagagagaaagcctctcttcctcagagcgatgtggaggtggagatccccactctg
gacgttcgtgtgggagacaactttgacgtgacgctgcagtttaagaaccacagtgaccag
cgccgcactgctgacgtgtacgtcaccggaaccgtggtgtattataccggagtcccgagc
gccgaggtggtgtttaaaactcccaaagtcaaactagatccactgcagaataaggatgag
aaagtgttggtgcgaggcgaggactacatgcataaactggtggaacaggcaaacatccac
ttcatcactacagggaagattaaagagacaggccagatcattacagccatgaaagtcatc
acaatacacaaccccaaactcattgtgaaggtcactggttctccaagagtgagtgaggaa
atgtacgtgtctgttgagttcacaaacccgtttaagttcaatctggagaatgtgcatcta
cgtatggagggtcctggaatcatgcccttcaaacgcaagcagtacagtctgattgctcca
ggcacctctataacgtggacagagacattcagtcccagacgggccggctccactaaactg
atagccagtctcgactgcgctgctctcagacaggtgtatggagagactgagctcaccatc
cagcaataa

DBGET integrated database retrieval system