KEGG   Sinocyclocheilus anshuiensis: 107699887Help
Entry
107699887         CDS       T04917                                 

Gene name
tmprss5
Definition
(RefSeq) transmembrane protease serine 5
  KO
K09636  
transmembrane protease serine 5 [EC:3.4.21.-]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     107699887 (tmprss5)
Peptidases [BR:sanh01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107699887 (tmprss5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 420 aa AA seqDB search
KVSGKVSAHKLVRVFAALCVLCLLGGVVIGVWFIVKILLRPNSAQSPVSLGDTKDTSFCN
VTEDTSVKDTRKVFYRISAENSLLEIQLEKLQTWLPVCYERWNSSLGTLVCRQLGYLRLS
KHKGVNLTDIGPNYTDGFVQITSEHQSNLESLWRFRVSCSIGKVIALKCFECGTRAKLPR
IVGGVEATLGRWPWQVSLYYSNRHICGGSVITNQWIVTAAHCVHNYRLPQVSGWVVYAGI
VTSNSAKLAQYQGLAVERIIYNKNYNHRTHDNDIALVKLRTLLNFSDTIRPVCLPKYDCD
LPGGTQCWISGWGYTQPDDVHIPEVLKEAPVPLISTKKCNSSCMYNGEITPRMLCAGYTE
GKVDACQGDSGGPLVCQDENVWRLVGVVSWGTGCAEPNHPGVYTKVAEFLEWIYEIIESY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
aaagtgtctggcaaagtgtcggcccataaactggtgagagtgtttgcagctctgtgtgta
ctctgtctgctgggaggtgttgtcattggagtttggttcatagtgaaaattctcttaagg
ccaaactcagctcagagccctgtgagtttaggagacactaaagacacatccttctgcaat
gtaaccgaggacacctctgtgaaggataccaggaaagtgttttacaggatcagtgctgag
aactctcttctggagatccagctggagaagctacagacgtggctgcccgtatgttacgag
aggtggaactcctctctgggaacgcttgtatgtcgacaactgggctatctgagattgtca
aagcacaaaggggtgaatctgactgatattgggccgaactacacagacggatttgtccaa
atcacctcagaacaccaaagcaatttggagagtttatggcgtttcagggtaagctgtagt
ataggaaaggtgatagcactgaaatgttttgagtgcggtaccagagcaaagttacctagg
attgttggaggagtggaagccactcttggcagatggccctggcaagtgagtctctactat
agtaaccgccacatctgtggaggatctgtcatcaccaaccaatggatagttacagctgct
cactgtgtccacaactacaggctacctcaagtgtccggttgggtggtttacgctggtatt
gtaaccagcaattcagctaaactggctcaataccaaggcttagctgtggagaggatcatc
tacaacaagaattacaaccacaggacgcatgacaatgatatcgctttggtgaaattaaga
actcttttgaatttctcagacaccatcagacctgtgtgtctacctaagtatgattgtgat
ctaccaggaggaacccagtgctggatctctggttggggatatacacagccagatgatgtt
catataccagaggttctcaaagaggcacctgtacctttaataagcacaaagaaatgcaat
agctcttgcatgtacaatggagagatcacccctcgaatgctctgtgctggatatacagaa
ggaaaagtagatgcatgtcagggggacagtggaggtcctctggtttgccaggatgagaat
gtctggaggctggttggtgttgttagctggggaacaggctgtgctgagccaaaccatcca
ggagtttataccaaagtggctgagtttttagagtggatatatgagattatagagagctac
taa

DBGET integrated database retrieval system