KEGG   Sinocyclocheilus anshuiensis: 107703174Help
Entry
107703174         CDS       T04917                                 

Definition
(RefSeq) glucokinase-like
  KO
K12407  
glucokinase [EC:2.7.1.2]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sanh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107703174
   00052 Galactose metabolism
    107703174
   00500 Starch and sucrose metabolism
    107703174
   00520 Amino sugar and nucleotide sugar metabolism
    107703174
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107703174
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    107703174
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     107703174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 476 aa AA seqDB search
MPCLTSARRQGMLSDFESVLERILMVEQILSEFLLSKEDLEEVMRRMRREMERGLRVETH
NEASVKMLPTYVRSTPEGSEVGDFLALDLGGTNFRVMLVKVGEDEERGWKVETKHHMYSI
PEDTMTGTAEMLFDYIAGCISDFLDKHNLKHKKLPLGFTFSFPVRHEDLDKGILLNWTKG
FKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHSCEVGMIVGTGC
NACYMEEMRKVELVEGEEGRMCVNTEWGAFGDNGELEDFRLEYDRVIDETSLNPGHQLYE
KLIGGKYMGELVRLVLLKLVNENLLFNGEASDLLKTRGAFETRFVSQIESDTGDRKQIYN
ILSTLGILPSELDCDIVRLVCESVSTRAAHMCGAGLAGVINLMRERRCQEQLKITVGVDG
SVYKLHPHFKERFHKLVWEINPHCEITFIQSEEGSGRGAALISAVAYKMATCMLTP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgccttacttcagctcgtaggcaagggatgctgagtgactttgagtcagtactg
gagagaattctcatggtggaacaaattttgtccgaatttctgttgagtaaagaagatcta
gaggaagtgatgaggagaatgcggagagagatggagaggggactgcgagtggagacacac
aatgaagccagcgtcaaaatgctgcccacttatgtccgctccacacctgaaggctctgag
gttggtgatttcctggcactggatcttggagggacaaactttcgagtgatgctggtgaaa
gtgggtgaggatgaagagcgcggctggaaggtggagacgaagcatcacatgtactccatt
cctgaagacaccatgactggcacagctgaaatgttgtttgattacattgccggctgcata
tctgacttcctggacaaacataatctgaaacataagaagcttccactgggattcaccttc
tcatttccagtccgtcatgaggatttagacaagggcattctgcttaactggactaaaggc
ttcaaggcctctggcgctgagggaaataacgttgtgggtctgctgagagacgccattaaa
agaagaggggactttgaaatggatgtggttgccatggtgaatgacacagtagccacaatg
atctcctgctactatgaagaccacagctgtgaagttggcatgatagtaggtaccggctgt
aatgcgtgttatatggaggagatgcgtaaggtggagctggtggagggagaggaggggagg
atgtgtgtgaacacagagtggggagcgtttggggacaatggtgaactggaggacttccgg
ctggagtatgatcgcgttattgatgagacatcactaaaccctggacatcagctgtatgag
aagctgattggtggaaagtatatgggggagcttgtgcgtcttgtgctgctaaaactagtg
aatgaaaatctgctgtttaacggcgaagcctcagacctgctgaaaacacgtggagctttt
gaaactcgcttcgtctcccagattgagagtgacacaggggacagaaagcagatctacaac
atcctaagcacactgggaatcttaccatcggagctggactgtgacattgtgcgtctggtc
tgtgagagcgtgtctacgcgagccgctcacatgtgcggggccggcctcgctggcgtcatc
aacctaatgagggaacgccgctgtcaagagcaactgaagatcactgtgggagtcgatggc
tctgtctacaaactacaccctcatttcaaggagcggttccataagcttgtgtgggaaatt
aatcctcactgcgaaattaccttcatccaatcagaagaggggagcggtcggggcgcggct
ctcatttccgctgtggcatacaagatggccacctgcatgctgacaccgtga

DBGET integrated database retrieval system