KEGG   Salmo salar (Atlantic salmon): 100137024Help
Entry
100137024         CDS       T04363                                 

Gene name
trp-iii
Definition
(RefSeq) trypsin III
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100137024 (trp-iii)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100137024 (trp-iii)
Peptidases [BR:sasa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100137024 (trp-iii)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100137024 (trp-iii)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
ssa05
AA seq 247 aa AA seqDB search
MKVIILLALFAVAFAAPIDDEDDKIVGGYECRKNSASYQASLQSGYHFCGGSLISSTWVV
SAAHCYKSRIQVRLGEHNIAVNEGTEQFIDSVKVIMHPSYNSRNLDNDIMLIKLSKPASL
NSYVSTVALPSSCASSGTRCLVSGWGNLSGSSSNYPDTLRCLDLPILSSSSCNSAYPGQI
TSNMFCAGFMEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNKPGVYTKVCNYRSWI
SSTMSSN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcattattcttctcgctctgttcgctgtggcatttgctgcccccattgacgat
gaggatgacaagattgttggagggtatgagtgcagaaagaactctgcatcctaccaggca
tcactgcagtctggctaccacttctgtggtggctccctgatctccagcacatgggtggtg
tctgctgctcactgctacaagtcccgcatccaggtgcgtctgggtgagcacaacattgcc
gtcaacgagggcactgagcagttcattgactcagtaaaggtcatcatgcaccccagttac
aacagccgcaacctggacaacgacatcatgctgatcaagctgagcaagcccgcctccctg
aacagctatgtgagcactgtggctctgccctccagctgtgccagctctggcacccgctgt
ctggtctctggctggggtaacctatccggcagcagcagcaactaccccgacactctgaga
tgcctggatctccccatcctgagcagcagcagctgcaacagcgcctaccctggacagatc
acctccaacatgttctgtgctggcttcatggagggaggcaaggactcttgccagggagac
tccggtggccccgtggtgtgcaatggtcagctgcagggtgttgtgtcctggggttacggc
tgtgcccagaggaacaagcctggtgtctacaccaaggtctgcaactacagatcctggatc
agcagcaccatgtcctccaactaa

DBGET integrated database retrieval system