KEGG   Salmo salar (Atlantic salmon): 100195068Help
Entry
100195068         CDS       T04363                                 

Gene name
tgm1
Definition
(RefSeq) transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase)
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100195068 (tgm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
ssa14
AA seq 779 aa AA seqDB search
MPGDRSTVSGSDVGRFHGVSPTTAQITNQKEAESNSKEQGSCRRWFQKMCPCCCRRQSSS
YDITDTVITDDGVKPATLPVPPQPHTGDNELEELMLSVRSVDLLSSKTGQNRLEHHTNLY
HGNELIIRRGQTFQIELDLSRPFNSNTDKLHLELKTGSLPMVSKGTHIIIKLVEELEDHS
WEAKIVKQKGNRIKLSVNSHPKAVIGQYKLTVMVKCPKREVAITHDPSKDVVMLFNPWCE
DDTVYMDDEEEKKEYVLNDIGRLYYGTETQIGARTWNYGQFLEGMLEACLYVLEKSEIPP
SGRGDSVNVVRVISAMINSPDDNGVLAGNWSGNYVGGVSPTAWSGSVDILMKYHKEGGQP
VKYGQCWVFSGVTTTVLRCLGIPCRSVTNFQSAHDTDVSLTTDVYFDENMEPLDHLNSDS
VWNFHVWNDCWMSRPDLPPGMGGWQALDSTPQETSQGTFRCGPASVTAIRTGQVYHKYDT
PFVFAEVNSDKIYWQRNLDGTFTQIHNEKKAVGHFISTKAVGSDERADITNLYKHTEESE
EERIAVETASRYGTRPDVYSTPMAKDVSVEVKMEGEGPRMGEDAQLTIVVTNLSSQPRRT
TLHSQVAVMYYTGVLKGTVQKNKLPVELMPNEVKTMQWVLPYQSYQNQLVDQAALMLTLS
GRVSETQQVLATQTNFRLRTPDLNIEPEGDAVVGKEMAAKITFTNPLPHKLRGVVFRVEG
LGLQKVREVVVGDVGSHSTVTLTEHFIPTQAGPRKLVAALDCKQLTQVHGVADIDVRSQ
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgccaggagaccggtcgacggtgagtggttctgatgtgggccgtttccatggcgtctcc
ccgaccacagcgcagataaccaaccagaaggaggcggagtctaattctaaggagcaggga
agctgtcgccgttggtttcagaagatgtgcccctgctgctgtcgacgccagagcagctcg
tatgacatcacagacactgtcatcacggatgacggggtgaaaccggccacgctccccgtg
cctcctcagccccacactggagacaacgagctggaagagctgatgttgtcagtgcgctcg
gtggatctactgagctctaagacgggtcagaaccgcctggagcatcacaccaacctttac
catggcaatgagctcatcatccgacgtggccagacgttccagatagaactggacctgtcg
cgacctttcaactccaatacagacaaactccacctggaactcaagacaggatccctcccc
atggtgtctaagggcacacacatcataattaaattggtggaggaactggaggaccacagc
tgggaggccaagatcgtgaagcagaaaggcaacaggatcaagctgtccgtaaactcgcat
cccaaagccgtgattggccagtacaagctcactgtgatggtgaagtgccctaagcgggag
gtggccatcacacacgaccccagcaaagatgtcgtcatgctgttcaacccatggtgtgaa
gatgacacagtgtacatggatgacgaggaggagaagaaggagtatgtgctgaatgacata
ggaagactctactacggtacagagacacagattggagctcgcacatggaactatggacag
ttccttgaggggatgctggaggcctgtctctatgtgctggagaagagtgagatccctccg
tctggtagaggagattctgtcaacgtggtcagagtcatatctgccatgatcaactcccca
gatgacaatggggtcctggcaggaaactggtcagggaactatgtaggaggagtttcccct
acagcctggagtggcagtgtggacattctgatgaaataccacaaggagggaggccagcct
gtcaaatacggacagtgctgggtcttctctggcgttaccaccacagtgctcaggtgtctg
ggtataccgtgtcgtagtgtaacaaacttccagtctgcccacgacacagatgtctcactc
acaacagacgtgtattttgatgagaatatggagccgctggaccacctcaactctgactct
gtttggaacttccatgtatggaacgactgttggatgtccaggccagaccttccacctggt
atgggtggctggcaggcgctagactccaccccccaggagaccagccaggggaccttccgc
tgtggccctgcctctgtcaccgccatccgcaccggccaggtctaccacaaatatgacacg
cccttcgtcttcgctgaggtgaacagtgataagatctactggcagaggaacctggacggt
accttcactcagatccacaatgagaagaaggctgtgggacacttcatcagcaccaaagct
gtaggctctgatgagcgcgctgacatcacaaacctgtacaaacacaccgaagaatcagag
gaagagcgcattgctgtggagacggccagtcgctatggcaccaggcctgatgtgtactcc
acgccgatggcgaaggatgtgagcgtggaggtgaagatggagggggaggggcctcgtatg
ggggaagatgcccagctgaccatcgtggtgaccaacctaagctcccagccgcgcaggacc
acgctccacagccaggtggccgtcatgtactacaccggggtgttgaagggaaccgtccag
aaaaacaaactgcctgtggaactcatgcccaatgaagtgaagaccatgcagtgggtccta
ccctaccagagctaccagaaccagttggtggaccaggctgctctgatgctgactctgtct
ggacgggtctctgagacccagcaggtccttgccactcagaccaacttcaggctccgcaca
cctgacctcaacatcgagcctgaaggggacgcagtggtgggtaaggagatggcagccaag
atcacgttcaccaaccctctgccacataaactgaggggtgtggtgttcagggtggaggga
ctgggcctgcagaaggtccgcgaggtggttgtgggtgatgttggaagccactccacggtg
actctgacagaacacttcatccctacccaggctgggcccaggaagttggtagcggctctg
gactgtaaacagctgacacaggtgcacggcgttgctgacatcgatgtccggagccaatga

DBGET integrated database retrieval system