KEGG   Salmo salar (Atlantic salmon): 106587025Help
Entry
106587025         CDS       T04363                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, mitochondrial
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:sasa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106587025
  Amino acid metabolism
   00310 Lysine degradation
    106587025
   00380 Tryptophan metabolism
    106587025
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     106587025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
ssa26
AA seq 1033 aa AA seqDB search
MHRLRTCAARLRPLTASQTAQNFSQQRRAAVPRTFQPFRCYTAPVAAEPFLNGTSSNYVE
EMYYSWLEDPKSVHKSWDVFFRNANAGAPPGMAHQSPLSLAGLPQAQSLAGAQPNVEKLV
EDHLAVQSLIRAYQIRGHHVAQLDPLGIMDADLDSHVPNDIITSSDKLDLAMFKDRLSIL
TVGGFYGLDESDLDKVFRLPTTTFIGGTETALPLREIIRRLEMAYCQHIGVEFMFINDLD
QCQWIREKFEKPGVMQFTLEEKRTLLARMVRSTRFEEFLQRKWSSEKRFGLEGCESLIPA
LKTIIDKSSEKGVENVVMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKY
HLGMYHRRINRVTDRNITLSLMANPSHLEAVDPVVQGKTKAEQFYCGDTEGHKVMSILMH
GDAAFAGQGVVYETFHLSDLPSYSTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVN
APIFHVNADDPEAVVYVCNVAAEWRATFHKDVVVDLVCYRRLGHNEMDEPMFTQPLMYKQ
IKKQKGVMQKYGEKLIAEGVVTRQEYEEEIAKYDKICEEAHVRSKDEKILHIKHWLDSPW
PGFFNLDGQPKSLTCPSTGLTEEELTHIGQVASSVPVEDFTIHGGLSRILKARGEMIKNR
TVDWALGEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRVCIPMNHVAPN
QAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKW
VRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPSITEDFAIRQLHDCNWIVV
NCSNPGNFFHVLRRQILAPFRKPLIVFTPKSLLRHPEARSNFDEMLPGTDFQRLIPDNGP
VAQNPAGVKRIVFCTGKVYYELTKERKAHGMEDTVAIARMEQLSPFPFDLVKAESEKYPN
ADLVWCQEEHKNQGYYDYVKPRMRTTIDRAKPVWYAGRPPAAAPATGNKKAHLVELKNFL
DTAFDLDAFKDQM
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcttaaggacttgtgctgcccggctgcggccgctgacagcctctcagactgct
cagaacttttcacagcagaggcgtgcggccgtaccaaggacttttcagccatttaggtgc
tacaccgcacctgtggctgccgagcctttcctcaatggaacaagctccaattatgtggag
gagatgtactattcatggctagaggaccccaagagtgttcataagtcttgggacgttttc
ttccgcaatgccaatgcaggtgctcccccaggcatggcccaccagagccctctgagcctg
gccggtctccctcaagcccagtctttggcgggggctcagcccaatgtggagaagctggtg
gaggatcacctggctgtccaatccctcattcgtgcctaccagatccgtgggcaccatgtt
gctcagctggacccgctggggattatggatgccgatctggactctcacgtccccaatgac
attataacgtcctcggataaactcgatctggcaatgttcaaggaccgtctcagtattcta
actgtcggagggttctatggactggacgagtcggacttggacaaagtgttccgcctgcct
accaccacctttatcgggggcactgagaccgccttgcccctgagggagataatccgccgc
ctggagatggcctactgccagcacatcggggttgagttcatgttcatcaatgacctagac
cagtgccagtggatccgggaaaagtttgagaagcccggcgtcatgcagttcaccctggag
gagaagaggaccctgctggcccgtatggttcgctccaccaggttcgaggagttcctccag
aggaagtggtcgtcagagaagcgcttcggcctggagggctgcgagtctctgatccccgcc
ctcaagaccatcattgacaagtccagcgagaagggtgtggagaacgtcgtcatgggcatg
ccacacaggggtcgtctgaacgtgctggccaacgtcatccgcaaggagctggagcagatc
ttctgccagtttgactccaaactggaggctgctgatgagggctctggtgacgtcaagtac
cacctggggatgtaccacaggaggatcaaccgtgtgacggaccgcaacatcactctgtcc
ctcatggccaacccctcccacctggaggctgtggaccccgtggtgcagggcaagaccaag
gccgagcagttctactgcggagacaccgagggacacaaggtgatgtccatcctgatgcac
ggtgatgctgccttcgccggtcagggcgtcgtgtacgagaccttccatctcagcgacctg
ccgtcctactccacccacggcacagtgcacgtggtcgtcaacaaccagattggcttcacc
actgacccccgtatggcgcgctcctctccgtaccccactgatgtggcccgggtggtcaat
gctcccatcttccacgtgaatgctgacgaccctgaggctgtggtgtacgtgtgcaacgtg
gccgccgagtggagagccaccttccacaaggacgtggtggtggacctggtgtgctaccgg
cggttgggacacaacgagatggacgagcccatgttcacccagcccctgatgtacaagcag
atcaagaagcagaagggagtgatgcagaagtatggcgagaaactcatcgcagagggggtt
gtcacgagacaggagtacgaggaggagattgcaaagtatgataagatctgtgaggaggca
catgttcgctccaaggatgagaagatcctccacatcaaacactggctggactctccctgg
cctggttttttcaacctggatggccagcccaagagcctgacctgcccgtccactggcctg
actgaggaggagctgacccacatcggacaggtggcctcctcagtgccagtcgaagacttc
accatccatggaggtctgagccgtatcctgaaggcccgaggggagatgatcaagaaccgc
acggtggactgggccctgggagaatacatggcctttggctctctgctcaaagagggcatc
cacgttcgcctcagcggccaggacgtggagaggggcaccttcagtcaccgacaccatgtg
ctgcacgaccagaacgtggacaagagagtttgcatccccatgaaccacgtggcccccaac
caggccccctacaccgtctgcaacagctccctgtctgagtacggcgtgctgggtttcgag
ctgggctttgccatggccagtcccaatgccctggtcctgtgggaggcccagttcggagac
ttccacaacacagcccagtgcatcatcgaccagttcatttgccccggccaggccaagtgg
gtccgccagaatggcatagtcctgctgctgccccacggcatggagggcatgggcccagaa
cactcctctgctcgtccagagagatttctccagatgtgcaacgatgatcctgatgtgctc
ccaagcatcacagaagactttgccattcgccagctccacgactgcaactggattgtggtc
aactgttcaaaccctggcaacttcttccacgtgctgaggaggcagattctggcgcctttc
aggaagcctctcatcgttttcacccccaaatccctgctgcgccaccccgaggcgaggtcc
aactttgacgagatgctgccaggcacagacttccagcgcctgatcccagataatggccca
gtggcccagaacccagccggggtgaagcgcatcgtcttctgcacagggaaggtgtactac
gaactcaccaaggaacgcaaggcccatggcatggaggacacggtcgccattgctcgcatg
gagcagctgtcccccttccccttcgacctggtgaaggctgagagcgagaagtaccccaat
gccgacctggtgtggtgccaagaggagcataagaaccagggctactacgactacgtcaaa
ccccgcatgcgcaccaccatcgatcgcgccaagcctgtctggtatgctggtcgccctcct
gctgcggccccagccacaggaaacaagaaggcccacctggtggagctgaagaatttcctg
gacactgccttcgatctggatgccttcaaggaccagatgtaa

DBGET integrated database retrieval system