KEGG   Salmo salar (Atlantic salmon): 106606040Help
Entry
106606040         CDS       T04363                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD2-like
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106606040
Enzymes [BR:sasa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106606040
Chromosome [BR:sasa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106606040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
ssa05
AA seq 1370 aa AA seqDB search
MPPYFDLIEENLYLTERKKNKSHRDIKRMQCECSMLSREERSRGMMACGEDCLNRLLMIE
CSSRCLNEGYCSNRRFQMKQHADFEVILTEDKGWGLRAARDLIPNTFVLEYCGEVLDHKE
FKTRVKKYASMKNIHYYFMALKNNEIIDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRV
GFFTSKTVTAGTELTFDYQFQRYGKEAQKCFCGAPSCRGFLGGENRVSVRAAAGKMKKER
PRKKDTSVSNALTTVDEELEALLENGEGLYDEKEVVSLCRLMVRVETMEQKLICLKLIQD
TQSPSCLKQFLDHHGLSLLWIFMVELSEAKGNSVNNIKLQFQIMKTLSVLPISTKNMLEE
SHVLSLIQRWAQTHTHSLPQPPGAEQDGYSSENTSRAQTPLNTPDGSSASVAKLGPELDS
DTPKRAVYRRLKISENSLDSAMSDASKASDGKEEEEEDEEEMEDEEVSRPEPPVESSKQS
KTELVVEAQAVEAQAVEAQAVEAQAVEAQAVEAQAVEAQAQTPTTEEPTEEPVTELKETP
EEVVETMEITEPEAESQDVKDQEEVDEKGGDEEVKEEGSEGRKESGEEEQQQASRSVEER
EVVAGEQANVEVQESSHIQPVQTEVTETPSEEQPAEEKEEETTTAETGTEDTEKAPGSQE
HPGQVAPEGPPEVAPGTEDAAHVVAPASEAPPPPSPVVPVEPAAVGTPSQDEEEGVSDVE
SERSQEALLSAVDIGDMAARLLDSWKDLKEVYRIPKKSQVEKEIHDRSRDRDAAPARTPS
GSRERDKERDRERDRERERDRERDRERDRERDRDWERDRERDRERDWDRDSEKTPRSTER
RRRRASTSPPPSAYERSSRRHEDRFDLANSSKKTRSITKERTKLSTEERRKLFEQEVAQR
EVQKQQQQLQQHQQQQRQQQLQTLAYDAALTYTTSPAGFIHYPPGYPLQTYVDPVNPNAG
KVLLPTPPVEPLVPATLVLEQTPPQALITELGMTSPSSTSQPPPVSNLSSISQHIHQPTT
PLELHHGTTQQYAQQPSVAGQDPGVGVLSVPAVSAPPQVSAGQGSYTTLWDPTTQQAVTV
QTQVAPQYQVVPAPPPTQTAIYYQGQPCQTIYSIPTAYPQANTPVLQAYADPAASYLHGQ
PVYTGHQQGVVVQQGGTVTTIVTSQTVQQEMPNALLVPNSMIDLPPPSPPKPKTIVLPPS
WKVARDGEGKIYYYHVITRQTQWDPPSSWDGASEDSHSLDHEAEMDLGTPTYDENPSKFS
TKTAEADTSSELAKRSKETFRKEMSQFIVTCLNPFRKPDCKLGRIVNTEDFKHLARKLTH
GVMNKELKSCKNPEDLECNENVKHKTKEYIKKYMQKFGNIYRPKEDTELD
NT seq 4113 nt NT seq  +upstreamnt  +downstreamnt
atgccaccatactttgacctgattgaggaaaacctgtatctgactgaacggaagaagaac
aagtctcatcgagacatcaagcgaatgcagtgtgagtgctctatgctctcgagggaggag
cggtctcgtggaatgatggcttgtggggaggactgccttaaccgtctgctgatgatcgag
tgctcatcacgctgcctgaatgaaggctactgctccaaccggcgcttccagatgaaacag
catgcagattttgaggtcatcctgactgaagataagggctggggactgagggcggccagg
gacctgataccaaacacttttgtgctggaatactgcggagaggtgttggaccacaaggag
ttcaagacacgggtgaaaaaatacgctagcatgaagaacatccactactatttcatggcc
ttgaagaataacgagatcatagatgccacactgaaggggaactgctctcgctttatgaac
cacagctgtgagcccaactgtgagacccagaagtggactgtgaacggccagctgagagtt
gggttcttcacctccaagaccgtcacagctggtacagagcttaccttcgattaccagttc
cagagatatgggaaagaggcccagaagtgcttctgtggggctcccagctgccgaggcttc
ctgggcggggagaaccgggtcagtgtaagagcagcggcagggaagatgaagaaagagcgc
cctcgcaagaaggacacctccgtgagcaatgcactcactacggtggacgaggaactagag
gctctgctggagaacggggagggtctgtacgatgagaaggaggtggtgtctctctgcagg
ctgatggtcagagtggagaccatggagcagaaactcatctgcctcaaacttatccaagat
acccagagcccatcctgtctgaagcagttcctggaccatcacggtctgtctctactgtgg
atcttcatggtggagctctctgaagccaagggcaacagtgtcaacaacatcaaactgcag
tttcagatcatgaagaccctgtcagtgctgcccatctccactaagaacatgttggaggag
agtcatgtcctgagcctcatccagcgctgggcccaaacacacacacactccctcccccag
ccccctggggccgaacaggacggctactccagtgagaacacgtcccgcgcccagacccct
ctcaacactcccgacggctcctctgcctccgtcgccaaactgggccctgagttggacagc
gacactcccaaacgggccgtttaccgtcgcctcaagatcagcgagaacagcctggacagc
gccatgtcggacgccagcaaggcctcggacggtaaggaggaggaagaggaggatgaagag
gagatggaggacgaggaggtctcacgacctgagcctccagtggagagcagcaaacagtcc
aagacagagctggtggttgaggcccaggcggttgaggcccaggcggttgaggcccaggcg
gttgaggcccaggcggttgaggcccaggcggttgaggcccaggcggttgaggcccaggct
cagactcccacaacggaggagccgacagaagagccagtcacagagctgaaggagacacca
gaggaggtggtggagaccatggagatcacagaacccgaagctgagagccaagacgttaaa
gatcaggaggaggtggatgagaagggcggtgacgaggaggtgaaagaggaggggagtgag
ggacggaaggagagcggagaggaggagcagcagcaggcaagtcggtcagtggaggagagg
gaggttgtggcaggagagcaggccaacgtggaggtccaggaatcatcacatattcagcca
gttcagacggaagttactgaaaccccttcagaggagcagcctgctgaggagaaggaagag
gagaccaccacagcagagactgggactgaagatacagaaaaggctccaggcagccaggaa
catccaggccaagtggcccccgagggtcccccggaggtggcccctggcactgaggacgct
gcccatgtagtggcccctgcctcggaggcccctccacctccctctccggtggtccccgtg
gagcctgcggcggtggggacgccctcgcaggatgaggaggagggtgtgtctgatgtagag
agcgagaggagccaggaagccctgctcagtgctgtggatataggagacatggctgctagg
ctgctggacagctggaaggacctgaaggaggtgtacaggatccccaagaagagccaggtg
gagaaggagatacatgatcgtagtcgagaccgagacgctgccccggctcgcaccccctcc
ggcagccgggaacgggacaaggagagggacagggaacgagatcgagaaagagaacgggac
agggagcgtgaccgggaacgtgaccgagaaagggacagggattgggagagagaccgggag
agagacagagagagagactgggacagagactctgagaagacaccccgcagcacagagaga
cggaggaggcgtgcctccacctccccaccaccctcagcatacgagaggagcagcaggcga
catgaggaccggtttgacctggctaacagcagtaagaagacccgttccatcaccaaggaa
cgcaccaagctgtccacagaggagcgcaggaagctgtttgaacaggaggtggcccagcgc
gaggtccagaaacaacaacaacagttacaacaacatcaacaacaacagcggcagcagcag
ctccagactctagcctacgatgcagccctgacctacactaccagcccagctggcttcatc
cactacccccccggctaccccctccagacctacgtggaccccgtcaaccccaacgcaggc
aaggtgctgctgcctacccctcccgtggagcccctggtcccagccaccctggtcttggag
cagacccctccccaggctctgatcaccgagctgggcatgacctctccctcctctacctcc
cagccccctccagtctccaacctctccagcatctcccaacacatccaccaacccactacg
cctctggagctccaccacggcaccacccagcagtatgcccagcagcccagcgtggcaggc
caggacccgggtgtaggcgtcctgtcagtgcctgctgtgtctgcgccgcctcaggtgtcg
gcgggccaggggagttacaccacactgtgggaccctaccacccagcaggctgtgacagta
cagacccaggtagcaccacagtaccaggttgtcccagcaccacctcccacccagacagcc
atctactaccagggtcagccctgtcagaccatctacagtatccccactgcctatccacag
gctaacacacctgtcctgcaggcctacgctgatccggctgccagctacctccacggtcag
ccggtgtacaccggtcatcagcaaggagtggtggttcagcaggggggtacggtcactacc
atcgtcacctcacagactgtccagcaggagatgcccaacgctctgttagtccccaacagt
atgatagacctgccccctccctctcctcccaaacccaaaaccatcgtcctgccccccagc
tggaaggtagcacgggacggagagggaaagatctactattatcacgtcatcaccaggcag
actcagtgggatcctcccagcagctgggacggggccagtgaagactctcacagcttagac
catgaggctgagatggacctggggacgcccacctacgacgagaacccctccaagttctct
actaagacagcagaggcagacacatccagtgagctggccaagaggagcaaggagacgttc
cggaaagagatgtcccagttcattgtgacctgcttgaatccgttccggaaaccagactgc
aaactgggacgcattgtcaacactgaggatttcaaacaccttgccagaaagctaactcac
ggcgtgatgaacaaggagctgaagtcctgcaagaacccagaggacctggagtgcaacgaa
aacgtcaagcacaagaccaaggagtacatcaagaaatacatgcagaagtttggcaacatc
taccggcccaaagaggacactgagctggactaa

DBGET integrated database retrieval system