KEGG   Salmo salar (Atlantic salmon): 106613781Help
Entry
106613781         CDS       T04363                                 

Gene name
dot1l
Definition
(RefSeq) DOT1 like histone lysine methyltransferase
  KO
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106613781 (dot1l)
Enzymes [BR:sasa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106613781 (dot1l)
Chromosome [BR:sasa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106613781 (dot1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
ssa10
AA seq 1549 aa AA seqDB search
MGEKLELKLKSPVGAEAAGYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTPPLKLNKRPSNGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQIINEMEMMEDDTFVDLGSGVGQVVLQVAAATNCK
HYFGVEKADIPATYAESMDKEFKRWMKWYGKKHGDYTLERGDFLSEVWKDRIANTSSVIF
VNNFAFGPEVDHQLKERFANMKEGAKIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPL
RGSVSWTGKPVSYYLHTIDRTILENYFHSLKNPKLREEQEAARRRQEKNSKDSKNTTPTK
AKEHKDSCGEDEQPGLLAVVKASPKPRRAKLLSKGRKLSARKRGRPKKAAVTAAERKSKK
SQSALELLHAKTISAAPPQDAYRSPQSPFYQLPPKVQHYASGQLLLGPTPPGLQQLLDNI
KVQYLQFMTYMKTPQYRIHLQQVLEQEKLKHRELSGQAEQLQTVCQTHKEKIKGLFHTKL
DELGVKALTVEDLLQAQKEISAHNHQLKEQTKQLERDMIELRDHSLLLLKSRCEELKLDW
SSLCLESLLKEKQALRRQISEKQRHCLELQISIVELEKSQRQQELLQLKSYSPCEGSPYR
KGLPRPTLDHDTPKLSLVVAGLSPELSINGTASPCFDRRGTKGELLSRYLPILPDHEIVP
PTPDARHRQLGHPLPDYTRFSPAKIALRRHLNQDSSTAHFRGLGFTGLRGDMGAITSPLD
AKLSCLSPNSSDSQQNNTPRSAERGGKEKSPAGGQGDAITSLPISIPLSTVHPSKLPVSI
PLASVVLPSRAERLRSTPSPVFQTGQTNGYSSSLGLMNGGSHSEDQDGSAPSPPPHGAPP
MGPTQGHSPPLSTGGVLQYADGTPRILPEDGAERQGESDSEPQDSKSRRRMFFSSSSSSS
SSSSGGAASRLRLGSARQSQHHLGSHSNHNNHHHSPGSQHTNSHGHGSQEERKRGRRKRS
STGAQPVSGSPKRKSFPGLSSTNHPSGSPLNINSMVNNINQPLEIAAISSPEQSGCSPCG
PDMDQPPVLKRERPLEINGSGRYSSAPSSDDDSGYPADSSSSRIERKIATISLESRDGPG
RSGDRERGRKSGGSSSNSTGSEVSSSSSSSSNSKWKSTFSPISDLKQPLSEVRQGGSPFG
TGREPRGMGTGTDSDSDHKPQQQRRGGEGAGGEPSGFQDIPLNPFLSQESGGRPGPGAQG
GSSSERQAMPKQKPRGEWELKTSSSMGNSQNLFISAAVSGGILSGKVGGSPVSSASGASV
GQYLGAQFPLGGASVLQSLFGAQTPGTSVSGAPRLVNGHSSLGSFSSAGLAGMFHHVVPS
VSSHQFGAALPVSGGLGSLLSLSSSQQHQHPAPSVSSSLPLPHSQHSRTQTVLHTPPPPT
LSLPPPPPYLNVSSSSVSSSDPSPSSRSEAFPSSLLQQRAQSSSLSVSSSSASVSPSSSP
SSRSFTVHYPPHLPPPTQASSSGGVSMWRTLGLPASYTSSSQHPGSRPR
NT seq 4650 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaagctagaactcaagctgaagtcgccggttggagccgaagctgctggctat
ccgtggccgttaccagtatacgacaaacaccatgatgctgctcatgaaatcattgagacc
attcggtgggtgtgtgaggagatcccggaccttaagctggccatggagaactatgtcctc
atcgactacgacaccaaaagctttgagagtatgcagagactttgtgacaaatacaacaga
gccatcgacagcatccaccagctgtggaaaggcacaactccgcccctgaagttaaacaag
cggccgtccaatgggctgctcagacacatcctgcagcaggtgtacaaccactcggtcacg
gaccccgagaagctcaacaactatgagcccttctcccccgaggtgtacggcgagacctcc
ttcgacctggtggcccagatcatcaacgagatggagatgatggaggatgacacctttgta
gacctcggcagcggggtgggacaagtggtgctgcaggttgccgcagcaacgaactgtaaa
cactactttggggtggagaaggcagacattccagccacttatgctgagtctatggataaa
gaatttaagaggtggatgaagtggtatgggaagaaacacggggactacacgctggagagg
ggggatttcctgtctgaagtgtggaaggacaggatcgccaacacaagcagtgttattttt
gtgaacaactttgcctttggtccagaagtggatcaccagctgaaggagcgctttgctaac
atgaaggaaggtgcgaaaattgtatcatcaaaaccttttgcacctctaaattttagaatc
aacagtcgaaacttgagtgacattggcacaataatgagagtcgttgagctgtctccgttg
aggggttcagtgtcctggacagggaagccagtttcctactacctgcatacaatagaccgc
accatacttgaaaactattttcatagtctcaaaaatcctaaactcagggaggagcaagaa
gcagctaggcgtcgacaagaaaagaatagtaaagacagtaaaaacaccaccccaaccaag
gcaaaggagcacaaggattcctgcggggaggatgagcaaccggggctattggcagtcgtg
aaggcgtcacccaaaccccgccgcgccaaactcctcagcaaaggccgcaagctgagcgcc
cggaagcgcgggcgtcccaagaaggctgcggtgaccgcagccgaacgcaagagcaagaag
agccagagtgccctggagctgctgcatgccaagaccatctctgcagcacccccccaggat
gcatacaggtcacctcaaagtcccttctaccagctacctcccaaagttcagcactatgcg
tctgggcaactgctgctgggccccactccccctggtctacaacagcttctagacaacatt
aaagtccagtacctccagttcatgacctacatgaagacacctcagtaccgcattcacctg
cagcaagtcctggagcaggagaagctaaaacacagagagctctctgggcaggcggagcag
ctgcagactgtgtgtcagacccacaaagagaagatcaaaggcctcttccacaccaaactg
gatgagctgggagtgaaggccctaactgtggaggacctgctgcaggcccagaaggagatc
tcagcccacaaccatcagctgaaggagcagaccaagcagctggagagagacatgatcgag
ctgagggaccacagcctgctcctgttgaagtctcggtgtgaagagctaaagctggactgg
agctctctgtgtcttgagagcctgctgaaggagaagcaggccctacgcagacagatctcc
gaaaaacagcggcactgtctcgagctacagatcagcatcgtggagctggagaagagtcag
aggcaacaggagctgctccagctcaagtcctacagtccctgtgagggttccccctaccgc
aagggcctccctcgccctaccctggaccacgacacccccaaactgagcctggtcgtggcc
ggcctcagccccgagctgtccatcaacggcaccgcctcgccctgcttcgacaggaggggc
accaagggagagctcctctcccgctacctgcccatcttgcctgaccacgagatcgtgccc
cccaccccggacgcccggcacaggcagctgggtcaccccctccctgactacacccgcttc
tccccagccaagatcgccctgcgcagacacctgaaccaggactctagtactgcacacttc
agaggcttgggcttcactggtctcaggggggatatgggcgccatcacctctccactagat
gctaaactgagctgcctgtctcccaactcatcagacagtcagcagaacaacacacccagg
agtgctgagagggggggtaaggagaagagtccagcagggggtcagggtgacgccatcacc
agcctgcccatcagtatccccctcagcacagtgcaccccagcaaactccccgttagcatc
cccctggccagtgtggtgctgcccagccgagcagagagactgaggagcacaccgagtcct
gtgttccagacaggccagaccaacgggtactcctctagcttagggctgatgaacggaggc
tctcactctgaggaccaggacgggtctgccccctcccctccccctcacggtgcccctcca
atgggaccaacacaaggccacagcccccccctcagcaccggaggggtcctccagtatgct
gacggcacccccagaatcctccctgaggatggggctgagcgccagggcgagtctgactcg
gagccccaggacagcaagtccagacgccgcatgttcttctcttcttcctcttcgtcgtct
tcctcctcctctgggggcgccgcgtctcgcctccgcctcggctcagccagacagagccag
catcacctaggtagccacagtaaccataacaaccaccaccactcgccgggctcccagcac
acaaactctcacggccatgggtctcaggaggaacgcaagcgtgggaggaggaagcgcagc
tcaacgggggctcaacctgtcagtggctccccaaagaggaagtcctttcctgggctcagc
tccaccaatcacccatcaggatccccactcaacatcaactccatggtgaacaacattaac
cagcctctggagatcgctgccatctcttccccggagcagtctggatgtagtccctgtggt
ccagacatggaccagccccccgtattgaagcgagaacgccctctggagataaatggctca
ggacgctactcctccgcacccagctctgatgacgactctggctaccccgctgacagctcc
agctcaagaattgaaaggaagattgccactatttccttggagagccgagatggaccaggc
agatcaggggacagggagcgcggaaggaagtcaggaggcagcagcagtaacagcacagga
agtgaggtctcctcttcatcttcctcctcatccaacagcaagtggaaatccaccttctcc
cccatctccgacctcaagcagcccctgtccgaggtgaggcaggggggctccccctttggc
acagggagagagccgcggggcatgggcacgggtacggactcagactctgatcacaaaccg
cagcagcagaggagggggggcgagggggccgggggtgagccctcagggtttcaggacatc
ccccttaaccccttccttagccaggagtctgggggccgaccggggccaggggcccaggga
ggaagcagctctgagaggcaggccatgcccaaacagaagccccggggtgagtgggaactg
aagacatccagcagcatgggcaacagccagaacctcttcatctctgcagccgtcagcggg
ggtatcctgagcggcaaggtggggggcagccctgtatcttcagcctcgggggcctctgtg
ggacagtacctgggggcccagttcccccttgggggtgcctctgtcctccagtccctgttc
ggagcccagacgcccggaacctcggtgagcggggccccgcgcctggtcaacggacactct
tccctggggagcttctccagcgctgggctggcaggcatgtttcaccacgtggtgccctca
gtgtcctcccatcagttcggggctgcgctgccagtctcaggaggcctcggctctctgctc
agtctctcctcctcccagcagcaccaacaccctgccccctctgtatcctcctccctccct
ctgccccattcccagcacagccgcacccagacagtgctgcacacccctccaccccccacg
ctctccctgccccctccaccaccatatctcaacgtctcctcctcctcagtctcgtcctct
gaccccagtccctcgtctcgctctgaggccttcccctcttccctcctgcaacagagagca
cagtcctcctctctctcggtctcttcctcctctgcgtctgtctccccctcttcttcacct
tcctctcgtagcttcacagtgcactacccccctcatctgccccctccaacccaggccagt
agctcgggtggggtcagcatgtggaggactctgggcttgcctgcttcatacacgtcgtcc
tctcagcaccctggctcccggcctagatag

DBGET integrated database retrieval system