KEGG   Streptomyces autolyticus: BV401_33055Help
Entry
BV401_33055       CDS       T04980                                 

Definition
(GenBank) hypothetical protein
Organism
sauo  Streptomyces autolyticus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
8003110..8004840
Genome map
AA seq 576 aa AA seqDB search
MTSVGHAPEKLMSLPALLARRAAENPDGLAYCYLRNGEDPDDRVTYAELRRQALVRAAEL
RRRDMRGRGAVLMYPTGLEFVRAWLGCTAAGVMGAPVQVPRNGQALRRLRSVADDSGTTW
VLTTAETRDRLLADFPGAPELRGLELLATDEFPEAATAGEPLPAAGPDDVALLQYTSGST
GTPKGVMVTHRNFWHNAAETDALWPTRGGTVVSWLPLFHDMGLLFGVVLPLWAGIPSYLM
GPEAFVRRPARWLEALSRFRGTHAAAPNFAYDLCVREAPPAPGCDLSAWRAAVNGAEPVR
LHTVRAFIEAFTPYGLDPRAVSPGYGLAEHTLKISGSGPGEPPRALTLSPADLGEGRVTE
TTDAAAVPVVSCGRTIGGTRVRIVDPATGRAAAPDRVGEIWATGPCVAAGYAGRERESEE
TFRARIADDADTAAFLRTGDIGFVRDGELYVTGRLKDLLVVKGRNHYPQDLEYSAERSHP
ALRPASAAAFAVDRGDREALVVVIEADGRALRAAGHDVLVSAVRERVRSDHRLEAEDVVV
IRRGTLPKTTSGKVRRGTCRQQYVDGTLVRVGGGPA
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgtcggccatgcccccgaaaagctgatgtccctgccggccctgctcgccagg
cgcgccgccgaaaacccggacggcctcgcctactgctatctccgcaacggcgaggacccg
gacgaccgggtcacctacgcggaactccggcgccaggccctcgtgcgcgcggccgaactc
cgccgccgggacatgcgcggccgcggtgccgtcctgatgtaccccaccggcctggagttc
gtccgcgcctggctcggctgcaccgccgccggggtcatgggggcgcccgtacaggtgccc
aggaacggccaggcgctgcgccggctgcgctccgtcgccgatgactcgggcaccacctgg
gtcctcaccaccgcggagacccgcgaccggctgctggccgacttccccggcgcgcccgag
ctgcgcggtctggagctgctggccaccgacgagttcccggaagcggcgacggccggggag
ccgctgcccgccgccggaccggacgatgtggcgctgctccagtacacctccggctccacc
ggcacgcccaagggcgtgatggtcacccaccgcaacttctggcacaacgccgccgagacc
gacgccctgtggcccacacggggcggcaccgtcgtctcctggcttccgctcttccacgac
atggggctgctgttcggcgtcgtgctgcccctgtgggcgggaattccctcctacctcatg
ggccccgaggcgttcgtccgccgcccggcccgctggctggaggccctctcccggttccgc
ggcacccacgccgcggcccccaacttcgcctacgacctgtgcgtacgggaggcacccccc
gcgccgggctgcgatctgtccgcctggcgggcggccgtcaacggcgccgagccggtgcgg
ctccacaccgtccgggcgttcatcgaggcgttcaccccgtacggcctggacccgcgcgcg
gtctcgccgggatacggcctcgccgaacacaccctcaagatcagcggcagcggccccggc
gaaccgccgcgggccctcaccctctcgcccgcggacctcggcgagggacgggtcaccgag
accacggacgccgccgcggtgcccgtggtcagctgcggccgcaccatcggcggcacccgc
gtgcgcatcgtggaccccgccaccggccgggcggccgcccccgaccgggtgggcgagatc
tgggccaccggcccctgtgtggcggccggatacgcgggccgtgagcgggagagcgaggag
accttccgggcccggatcgccgacgacgccgacaccgcggcgttcctgcgcaccggcgac
atcggcttcgtccgcgacggcgagctctatgtcaccgggcggctcaaggacctcctcgtc
gtcaagggccgcaaccactacccgcaggacctggagtactccgccgagcgcagccacccc
gcgctgcgccccgcgtccgcggccgccttcgcggtcgaccggggcgaccgggaggccctc
gtggtggtgatcgaggcggacggccgggcgctgcgcgcggccggccacgacgtgctggtc
agcgccgtacgcgagcgggtgcgcagcgaccaccggctggaggccgaggacgtcgtcgtc
atccgccgcggcaccctgcccaagaccacgagcggcaaggtgcgccgcggcacctgccgc
cagcagtacgtggacggcaccctcgtacgggtcggcggaggcccggcatga

DBGET integrated database retrieval system