KEGG   Sulfobacillus acidophilus TPY: TPY_1860Help
Entry
TPY_1860          CDS       T01576                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TPY_1860
Enzymes [BR:say01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     TPY_1860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEJ40040
UniProt: F8I7X7
LinkDB All DBs
Position
complement(1767741..1769216)
Genome map
AA seq 491 aa AA seqDB search
MRLNNFIGGQWVAPETGQYRPDIDPANGEVIAEVPLSSRQDTERAIAAAADAYPRWRKVP
GPKRGEILFRVGQILQARKRELAEKMTREMGKVRLEAEGDVQEGIDMAFYMAGEGRRSFG
FTTPSELPDKFAMALRDSIGVAGIITPWNFPMAIPTWKIFPALVSGNTVVFKPATESPYL
AYELVKILEEAGIPPGVVNLVFGSGREVGETLLTDPRVQLISFTGSNETGRHVAQVAGGL
LKRVSLELGGKNAVIVMDDANLDLAVDGIIWSAYGTTGQRCTACSRIIVHEGIYDRLRDR
LKERIRGLRLGHGLSAETDVGPLVNQAAVEKVQHYVELGQQEGAHLEIGGGIPDDPTLAH
GHFYLPTLFTDVTPEMRIANEEIFGPVLSMIRVKSLDEAIEVNNRVSYGLSSSIFTQDVN
RAFQAIRDLATGIVYINAGTTGAEIHLPFGGTKGTGNGHRESGEAAIDFFTEWKAVYVDY
SGRLQRAQIDT
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgcgactgaacaactttattggcgggcaatgggtagcgccggaaaccgggcaataccgg
cccgacattgacccggccaatggagaggtaatagcagaagttccgttatccagccgtcag
gacaccgaacgggccattgcggccgccgcggacgcctatccacgttggcgtaaggtgccg
ggacccaagcggggggaaatcctgtttcgagtgggacagattttacaagcccgcaagcgg
gaactggcggaaaaaatgacccgggaaatgggcaaggtgcgtttggaagccgagggcgac
gtacaagaaggcatcgacatggccttttatatggccggggagggccggcgcagcttcggt
ttcaccaccccgtcggaattaccggacaaatttgcgatggctctacgcgattccattggg
gtcgccggtattatcacaccatggaactttccgatggccataccgacctggaagattttc
ccggccttggtttcgggcaatacggtcgtctttaagccggctaccgaatcaccctatttg
gcgtacgaattggtcaaaattttagaggaagcgggaattccgccgggcgtcgtcaacttg
gtattcggttccggtcgtgaagtcggcgagacgttattgaccgatccgcgggtgcagtta
atttcctttaccggatccaacgaaaccggtcgtcatgtggcgcaggtggccggcgggctt
ttaaagcgcgtctccctggaactggggggtaaaaacgcggtcattgtcatggatgatgcg
aatctcgacctggcggtcgacggcatcatctggagtgcttacggtaccaccggccaacgt
tgtacggcctgttcgcgcattattgtgcacgaggggatttatgaccgcttgcgagaccgc
ttgaaagagcgcattcgcggccttcggttaggccacgggctttccgccgagaccgatgtc
ggccctttggtgaatcaagcggcggtggaaaaagttcagcattatgtcgagttggggcaa
caagaaggcgcccacctggagatcggcggggggattccggacgatccgactttggcgcac
ggccatttctatctccccaccctgtttaccgatgtgacgccggagatgcggatcgctaac
gaagagattttcggcccggtattatccatgattcgcgtgaaatctctcgacgaggcgatc
gaggtcaacaaccgggtgagttacggcctttcctcgtcgattttcacgcaggatgtcaac
cgggcctttcaagcgatccgtgatttagcgaccggtattgtctatattaatgcgggaacc
accggggcagaaattcatttgcccttcggcggcaccaaaggcacaggcaatggccaccgg
gaatccggggaagcggcgattgactttttcacggagtggaaggcggtctatgtggattac
agcggacgcttgcagcgggcgcaaatcgacacctag

DBGET integrated database retrieval system