KEGG   Shewanella amazonensis: Sama_1817Help
Entry
Sama_1817         CDS       T00445                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
saz  Shewanella amazonensis
Brite
Enzymes [BR:saz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Sama_1817
Peptidases [BR:saz01002]
 Metallo Peptidases
  Family M2
   Sama_1817
Exosome [BR:saz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sama_1817
CD molecules [BR:saz04090]
 Proteins
  Sama_1817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2213192..2215048
Genome map
AA seq 618 aa AA seqDB search
MLRPAKLALGVALALGLSACQDEQHSVAVNKDVAAVTAVSSNVSTQDAIDFINQAEAELA
ALSLEANRAEWIYSNFITEDTASLSAAVNEKVTATSVRLATEAAKFAEVELDAVNARKLN
MLRSALVLPSPLDPAKNAELAGIVAQLNGLYGKGKYCFADGRCLTQPELSALMAESRDPE
LLKEIWAGWRDIAKPMRPLFEREVVLANEGAKDLGFANLSELWRSQYDMAPDAFSTELDR
LWGQVKPLYDSLHCYVRGELNAQYGDDVVPRTGPIPAHLLGNMWAQQWGTIYPLVAPKDA
DPGYDVTALLAKQGYDEHKMVQQAESFFTSLGFDKLPDTFWSRSLFVQPKDRDVVCHASA
WDLDNADDIRIKMCIQKTAEDFTVIHHELGHNFYQRAYKNQPFIFKNSANDGFHEAIGDT
VALSITPKYLQQIGLLDTVPDASKDIGLLLKQALDKVAFLPFGLMIDQWRWKVFSGEITP
ANYNQAWWDLRLKYQGVMAPVARSEADFDPGAKYHVPGNVPYTRYFLAHILQFQFHRSLC
DVAGDQGPVHRCSIYGNQEAGAKLNQMLEMGSSKPWPEALAVVTGKQEMDASAVLDYFAP
LKTWLDEQNTHANRQCGW
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
ttgttacgccccgccaaattggccttgggtgtagcccttgcactcggcctcagcgcctgt
caggacgagcagcactcagttgctgttaataaagacgttgctgcagttactgcggtgtcc
tctaacgtatccacccaggatgcgattgattttatcaatcaggcggaagccgagcttgcc
gcgctgtctctagaggctaaccgtgcagagtggatatacagtaactttatcaccgaagac
acagcatccttatcggccgcagttaacgaaaaggtgaccgccacgtcggtacgtttagcc
actgaagctgccaaatttgcggaagttgagcttgatgccgtgaacgcccgtaagctcaat
atgctcagaagcgcactggttctgccctcgccactcgatcctgcaaaaaatgccgagctg
gccggtatcgttgcccagctcaacggcctctatggcaaaggcaaatactgctttgccgat
ggtcgctgcctgacccagccagagctctctgccctgatggccgaatcccgtgaccctgaa
ctcttaaaagaaatctgggctggctggcgtgacattgccaaacccatgcgtccgctgttc
gaacgcgaagtggtacttgccaatgaaggagccaaagacctgggctttgccaatttgtct
gagctgtggcgcagtcaatacgatatggcgcctgatgcattttccaccgaacttgaccgc
ctctggggtcaggtaaaaccgctttatgattcgctgcattgttatgtgcgtggtgagctc
aacgcgcaatacggcgacgatgtggtgccaagaaccggtccaatcccggcacatctcctg
ggtaacatgtgggcccagcagtggggcaccatttaccctctcgttgcaccaaaggatgct
gacccaggctatgacgtgacagccctgcttgccaaacagggttacgatgagcacaaaatg
gtgcagcaggccgagagcttctttacttcactgggttttgacaagctccccgataccttc
tggagccgttcattattcgtgcagcccaaagaccgtgatgtcgtctgtcacgcctctgcc
tgggatttggataacgcggatgatatccgtatcaagatgtgtatccagaaaaccgcagaa
gactttaccgtgatccaccacgagctgggccacaacttctaccagcgtgcttataagaat
cagccttttatctttaaaaacagcgccaacgatggcttccatgaagccattggcgatacg
gtcgccctgtccatcacacccaagtacctgcagcagattggtctgctggatacggttccc
gatgcgtcaaaagacattggtctgctattaaaacaagccctggacaaggtcgctttcctg
ccctttggtctgatgattgaccagtggcgctggaaggtattcagcggtgaaatcacgcct
gcgaactacaaccaggcatggtgggatctgcgcttgaagtatcagggtgtgatggcgcct
gttgcgcgatcagaagccgattttgacccgggtgcaaaataccacgtgccgggcaatgtc
ccttacacccgttacttcctggctcacattctccaattccagttccaccgttccctgtgc
gacgtggccggtgaccagggcccggtgcatcgctgctcgatatacggcaaccaggaagcc
ggcgccaagctcaatcaaatgctggaaatgggttcgagcaagccctggcccgaagcgttg
gccgtggtgactggaaaacaggaaatggacgccagcgccgtactcgactattttgcgccg
ctgaaaacctggctcgacgagcaaaacacccacgccaatcgccagtgtggttggtaa

DBGET integrated database retrieval system