KEGG   Candidatus Saccharibacteria bacterium GW2011_GWC2_44_17: UW38_C0001G0154Help
Entry
UW38_C0001G0154   CDS       T04605                                 

Definition
(GenBank) hypothetical protein
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
sbag  Candidatus Saccharibacteria bacterium GW2011_GWC2_44_17
Pathway
sbag00500  Starch and sucrose metabolism
sbag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UW38_C0001G0154
Enzymes [BR:sbag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     UW38_C0001G0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 Hyr1
Motif
Other DBs
NCBI-ProteinID: AKM80022
UniProt: A0A0G4AZ61
LinkDB All DBs
Position
135071..136303
Genome map
AA seq 410 aa AA seqDB search
MSQKKAITLYLHVHQPFRVRQYSVFDTGESHDYFNEPNYNSERNNEAVFKKVADKSYRPM
NALLLKLLREHEDFKLSLSITGTFIDQAEQWAPDVIESFQALVATGKVEIVAETYHHSLA
FFYSRNEFEKQVTLHRDKIKTLFGVTPKVFRNTELAYNNELAQWADSQGYEGILAEGWDP
ILQWRSPNYVYRPPATKNISLLLKNYRLSDDLAFRFSDQSWGEWPLTADRYTDWLRQATE
DAPLVNLFMDYETFGEHQWHETGIFGFFEETVRTWLQDKDNTFTTVSDAITANPPSDEID
VPYTVTWADTERDLSAWNGNRLQQEALKYLYRLESDILRTKDEQLINDWRYLQASDLVYY
MCTKNLDDGAVHAYFSPYESPYDAFLFFMNVIRDLRWRLIQDHKTGGLHG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcaaaagaaagcaatcactctatatctgcatgtccaccagccttttcgcgtgaga
caatatagtgtttttgatactggcgaatcacacgactacttcaatgagcctaattacaac
tcagaacgcaacaatgaggctgtatttaaaaaagtagccgacaagtcatatcgtccaatg
aatgcgctcctccttaagctgctgagagaacacgaggatttcaagctgtcgctcagcatt
acgggcactttcattgatcaggcagaacaatgggcgccagacgtcattgaaagtttccag
gcacttgttgctacgggaaaggttgagattgtcgccgagacataccatcattcgcttgca
ttcttttatagtcgaaatgaatttgaaaaacaggttactctgcaccgcgataagatcaaa
acattatttggagttaccccaaaggtatttcgaaatactgagcttgcgtacaacaatgag
ctagcgcaatgggctgacagtcaaggatatgaaggtattcttgctgaaggatgggatcca
atcttgcagtggcgcagtccaaactacgtatatcgtccgcctgcgactaaaaatataagt
cttctcctcaagaattatcgactgagtgatgacctcgctttccgctttagcgatcagtca
tggggtgaatggccacttacggctgatcgttatactgattggcttcgtcaagctactgag
gacgcaccgctcgtcaatctctttatggactatgaaacattcggtgagcaccaatggcat
gaaacgggtatatttggcttctttgaagaaaccgtacgaacatggcttcaagataaagat
aatacatttactacggtcagtgatgcgatcaccgccaaccctccatctgatgaaatcgat
gttccatatactgttacctgggctgatacagagcgtgacctaagtgcctggaatggcaat
cgcctacaacaagaagcactcaagtatctttatcggcttgaaagtgatatcctccggacg
aaagatgagcagctcatcaatgattggcgctatcttcaagcatcagatcttgtctactac
atgtgtactaaaaaccttgatgatggcgccgtgcatgcttacttcagcccctacgaatca
ccgtacgatgcattcttgtttttcatgaatgtaataagagacctcagatggaggctcata
caagatcataagactggaggacttcatggctag

DBGET integrated database retrieval system