KEGG   Shewanella baltica BA175: Sbal175_2295Help
Entry
Sbal175_2295      CDS       T02014                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sbb  Shewanella baltica BA175
Brite
Enzymes [BR:sbb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Sbal175_2295
Peptidases [BR:sbb01002]
 Metallo Peptidases
  Family M2
   Sbal175_2295
Exosome [BR:sbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal175_2295
CD molecules [BR:sbb04090]
 Proteins
  Sbal175_2295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2708855..2710720
Genome map
AA seq 621 aa AA seqDB search
MVISLNRRSKIALTVALTLGLTACNDAQSKTDKPASTEAAVINTAPDKVQAIAFINDAEA
KMAELSIESNRAEWIYSNFITDDTAALSAAVGEKVSAASVKFATEAAKYANVQLDPVNAR
KLNILRSALVLPAPLDPAKNAELAQISSELNGLYGKGKYCFADGKCMTQPELSSLMAESR
DPATLLEAWKGWREIAKPMRPLFQREVELANEGAKDLGYANLSELWRSQYDMKPDDFSQE
LDRLWGQVKPLYESLHCYVRGELNKEYGDTVAPTTGPIPAHLLGNMWAQQWGNVYDLVAP
DNADPGYDVTELLAKNGYDEHKMVKQAEGFFTSLGFAPLPESFWARSLFVQPKDRDVVCH
ASAWDLDNLDDIRIKMCIQKTAEDFSVIHHELGHNFYQRAYKQQPFLFKNSANDGFHEAI
GDTIALSITPSYLKQIGLLDEVPDASKDIGLLLKQALDKIAFLPFGLMIDQWRWKVFSGE
ITPAQYNQAWWDLREKYQGVKAPTKRSEADFDPGAKYHVPGNVPYTRYFLAHILQFQFHQ
ALCETAGDKGPVHRCSIYGNQAAGEKLNKMLELGLSKPWPEALKEVTGKETMDAKAVLDY
FAPLKTWLDEQNTTANRQCGW
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggttatttcattgaatcgtcgcagtaaaatcgccctcacagtggccttaacgctggga
ttaacggcctgtaatgatgcacaaagcaaaaccgacaagcctgctagcactgaagcggct
gtcatcaataccgccccagataaagtacaagccattgcttttattaacgatgctgaagcc
aaaatggctgaattatcgattgaatctaatcgcgccgaatggatttacagcaactttatt
accgatgataccgcggccctgtctgccgcggtcggtgaaaaggtcagcgcagcgtcggta
aaatttgcaacagaggcggctaagtacgccaatgtgcaactcgatcccgttaatgcccgc
aaactcaatatattacgcagtgcgttagtgttacccgcaccgctcgatcctgcgaaaaat
gccgagcttgcgcaaattagctcagaattaaatggcttatacggcaaaggaaaatactgt
tttgccgatggcaagtgtatgacccagcctgagctatcgagcttgatggccgaatcacgg
gatcccgctacgttgctggaagcgtggaaaggctggcgtgaaattgccaaacctatgcgt
cccttgtttcaacgtgaagtggaactggccaatgaaggcgcgaaggatcttggttatgca
aacctgtctgagctatggcgcagtcaatatgatatgaaacccgatgatttttcacaggaa
ctcgatcgtctttggggccaagtgaaacccctttatgaatcattgcactgttacgtgcgc
ggtgaactcaataaagaatacggcgataccgttgcaccgactacaggacctatccctgca
catttactcggcaatatgtgggcccagcaatggggaaatgtgtatgatttagtcgcccca
gacaatgccgacccgggttacgatgtcactgagctactggcaaaaaatggctatgacgag
cataaaatggtgaaacaagccgaaggcttcttcacgtctctaggatttgcgccattgcca
gaaagtttttgggcacgttctctatttgttcagccaaaggatcgtgatgtggtttgccac
gcttcggcatgggatctcgataatctcgacgatattcgcataaaaatgtgtatccaaaag
accgccgaagattttagcgtgatccatcacgaacttggacataacttctatcaacgcgct
tataagcagcaaccattcctgtttaaaaacagcgccaacgatggtttccatgaagcgatt
ggtgacacgattgcgctatcgatcaccccaagctacttaaaacagattggcttattagac
gaagtacctgatgcctctaaggatattggcctcttactgaagcaagctttagataaaatc
gccttcttgccctttggtctgatgatagatcagtggcgctggaaagtgtttagcggtgaa
atcacacctgcccaatataaccaagcatggtgggatctcagggaaaaataccaaggcgta
aaagcaccgacgaagcgcagcgaagctgactttgatccaggcgctaaataccatgtgcca
ggtaatgtgccttacactcgttacttcctcgcgcatattctgcaattccagttccatcaa
gcgctgtgtgaaactgcgggcgataaaggtccggttcatagatgcagtatttatggcaat
caagctgcgggagagaaactcaataagatgctcgagttgggcttaagtaaaccttggcct
gaagcattgaaagaagtcaccggcaaagaaaccatggatgccaaagctgtgctcgattac
ttcgcaccgcttaaaacatggttagatgagcaaaataccaccgcaaaccgccagtgtggt
tggtaa

DBGET integrated database retrieval system